| Guestbook Archives | Current Guestbook | Alan Rickman Home page
|
Start reading at bottom of page.
Oh no - Kevin Costner...? Personally, I'd say your TiVo is cursed for sure, LOL!
Hmm, I don't know if Alan would appear on Inside the Actors Studio, but that WOULD be a
delicious episode.
Virginia, a Rickmaniac
NYC, - Monday, March 31, 2003 at 23:13:05 (PST)
As Snape Wench No 1 it's about time the rest of you SN's started to behave
yourselves and got into line(behind me). Dee, you will forfeit your place in the hierarchy
if you teach PM anything that George has taught you (think spreadeagled). CdC you are too
quiet what are you up to? Cathy, Ella, CJ I hope you are studying diligently as we need
POINTS. The PM is not happy and will be handing out detentions all over the place!? Get
busy.
Gissing's Girl <repentinginthemasterschambers@snape.comfoo>
UK - Monday, March 31, 2003 at 23:06:54 (PST)
I don't know what little peculiar corner of hell I've been sentenced to, but my TiVo
is cursed. Guess which "Inside the Actors Studio" was the first one taped for
me??? The one with KEVIN COSTNER! Aargh! Actually, I wonder if they'd ever ask Alan to
come on. I'd love to hear his answers to the questionaire at the end (especially favorite
sounds, and favorite curse word). I'll have to have a chat with James Lipton. Sorry to the
KC fans out there, I just can't help myself, it was too weird.
saturnine
- Monday, March 31, 2003 at 22:41:33 (PST)
Thanks for the painting with light stills Kate.
GML
UK - Monday, March 31, 2003 at 22:35:30 (PST)
WOW! Its not often you can gross CdC out! Surely I win extra points for that!
Aussiegirl
- Monday, March 31, 2003 at 22:23:30 (PST)
**DUH** Sorry Dee..got Snape on the bed..I mean brain! lol..my email is
Snapefan2@aol.com (no foo)! lol
Cathy <can'tgetenoughofsnape@houseofsnape.comfoo>
FL USA - Monday, March 31, 2003 at 22:10:44 (PST)
Cathy--would love to email you!! Uh, what is your email address???? Too much Snape makes a girl forgetful!! Mine's deebartholomew42@yahoo.comSnape/GeorgeWench
CdC--another bloody brilliant idea--the Library!!! Thank you ever so.
The HoNs are pretty darn quiet--Hmmmmmm . . .
I believe it is 6:50 a.m. in London!!
Dee
Pasadena, CA USA - Monday, March 31, 2003 at 21:52:45 (PST)
Thank you Ella! I can't wait to see my "personlized Snape"! LOL..I didn't
realize that "it's" was in the e-mail address Ella..**DEE** email me, I can help
you with the January Man DVD...and I am a proud owner of a DVD/VCR combo..as I have no
idea what SnapeWench # I am!.....
Cathy..uh what the hell Snape # am I? <ImASnapeWenchandProudOfIt!@HouseOfSnape.comfoo>
FL USA - Monday, March 31, 2003 at 21:39:02 (PST)
"Polished and mounted"-snort! :) Things are getting interesting over in
Colonel House!
saturnine
- Monday, March 31, 2003 at 21:22:19 (PST)
Ella, I would be honored to be No. 7 House Wench! :) I hope the rest don't mind my
joining in the fun. Can't wait to get my welcome goodies...
saturnine
aka-lucky7, - Monday, March 31, 2003 at 21:20:28 (PST)
Aussiegirl: Ewwwwww! Some time you'll have to tell me how you *raise* the dead over
there.
I'd love to pursue this but reality is upstairs and I planned to join him (or was it unto
him) about half an hour ago! Night night
Carolyn, dear Carolyn
landoftheliving, at least, CO USA - Monday, March 31, 2003 at 21:05:21 (PST)
Brrhhh Aussiegirl is it an icy Popsicle too?
Janine (still not sure which house and would rather be the enticing guest at times)
Melb, Vic Australia - Monday, March 31, 2003 at 20:52:33 (PST)
Why am I getting visions of Lady Di and James Hewitt with that description of indoor
horseback riding????
Aussiegirl
- Monday, March 31, 2003 at 20:51:22 (PST)
CdC, for your information, tonight at Colonel House ("where the air is always
full of spices"), our dear Brandon is providing us each with thorough individual
instruction in the art of musket polishing, followed by indoor horseback riding lessons
and capped by a lovely group sing around the pianoforte (the Colonel is quite musical, you
know, especially after he's been polished and mounted).
Kate
San Francisco, - Monday, March 31, 2003 at 20:44:15 (PST)
Well CdC, just a little necrophilia over here at the House of Jamie (well, you did
ask!!!)
Aussiegirl
- Monday, March 31, 2003 at 20:36:03 (PST)
Back from photo-scrapbooking and got a few minutes before picking up the kids! Ella
- surely AR is just feeling a little "paternal" with all those sweet young
things - you know, lovely ole Uncle Alan giving us a cuddle! Although looking at this
weeks New Idea (you know the one with Nicole Kidman on the cover *AGAIN* - have these
people no imagination - probably should be called the "No Idea")anyway, one of
the many earth-shattering stories is "J.Lo sparks catfight - 'Get your hands off my
man, Salma'" Sooooo it appears Salma doesn't mind getting a bit snuggy with all the
boys!
Aussiegirl
- Monday, March 31, 2003 at 20:34:13 (PST)
What's going on at the other Houses? Darning tights at the HoN? Live poetry readings
and weak tea with The Colonel? Hmmm? Snide, who me?
Carolyn, dear Carolyn
CO USA - Monday, March 31, 2003 at 20:29:39 (PST)
Kate: You wouldn't be able to get me off of him with a putty scraper!
Carolyn, dear Carolyn
CO USA - Monday, March 31, 2003 at 20:19:03 (PST)
Push, push, shove, elbow GET THE HECK OUTTA MY WAY, WENCHES! Sheesh, these other Snape-hungry women are starting to pile up everywhere!
Ella, darling of cyberspace, please, can I have a personalized Snape picture, too? Something that, maybe, alludes to our (Severus' and my) penchant for being "up to something?" BTW, the phenomenon of being in two places at one time is called "bilocation" and it is ascribed to many saints. Dee, a saint? Omigoddess! Does this not strain credulity?
Dee: thank you for the reminder to flog libraries. LIBRARY PLUG--Closet Land is available via interlibrary loan.
Whoops, whoa, get back here #5! Turn your back and they've invented another infraction
worthy of detention! [Excuse me while I go find some sort of appliance to fry. Oh, Iknow!
I'll bake a casserole in the Tupperware! Noxious fumes and melted plastic ought to be good
for, at least, an eyebrow raise and a roar!]
Carolyn, dear Carolyn <potionmasterslap@darkcorneroflibrary.comfoo>
CO USA - Monday, March 31, 2003 at 20:12:38 (PST)
Kate, you have a good point! Yes, yes, I'm absolutely certain that the women were the perpetrators! I would do the same in their shoes. (Who am I kidding?! I would be clinging for dear life and then they'd have to get out the jaws of life.)
Saturnine, welcome to wenchdom :-) If you don't mind, I'm rather attached to my no.5 position (it's my lucky no.), and was wondering if we could assign postions to new wenches according to date of joining E.L.O.O.S.W.? If so, that would make you lucky no. 7 wench :-) E-mail me at its_ellamentary "at" msn "dot" com for a welcome packet.
Speaking of witty fanfics, Snape lovers check this one out:
http://www.angelfire.com/realm/zentraya/HPTales.html. It's called "Snapeology"
and about a Slytherin girl in love with her head of house and her attempts at earning his
affections. (No, no, it's not like that. Trust me. It's rated "G" and the
cutest, funniest Snape story I've read. I think the author captured his essence to a
"T". She's very, very good.)
Ella
- Monday, March 31, 2003 at 20:09:36 (PST)
Tuxedo junction: Y'know, I'm not crazy about EBay and I would never bid on them, but
somebody (who seems to be a professional photog) is selling a load of unbelievable photos
of AR taken at press events and out and about. There's one of him in a tux that is
absolutely lethal. (search on his name to get to the AR auction page). This is what we're
reduced to whilst waiting for the Man to do something new. All together now, "I'm
waitin' for mah man ..." (with apologies to Lou Reed). Hey how about another pop
quiz? Any of my Colonel housemates online?
Kate
San Francisco, - Monday, March 31, 2003 at 20:06:35 (PST)
Hi Aussiegirl well I have the New Idea and I am out to win, shame about the other million entries with cultural non HP stalking values. There is a lovely Snape Photo in the latest Starburst Mag. A good quality print of him in the Dungeons at his desk. Yet at $18.80c I thought I best be good and check out the shops for a Snape doll first. I mean I could put it away for Mothers day.(for me yet if it was a Col. B doll I am sure my mum would like it. For after watching S&S for the fiftieth time. And finding out AR was her age she was ready to pack her wheelchair and head for England. Yet I warned her of the rather large line of women with the same idea and the 35 year relationship that barred her way).
My DH agreed that Judas Kiss is his worst movie yet he says that now when AR speaks he
keeps on thinking of that Beckett play.
Janine
Melb(2.01 p.m.), Vic Australia - Monday, March 31, 2003 at 19:58:16 (PST)
Ella: Maybe Salma Hayek and the other sexy young things are snuggling up to HIM, not
the other way around? I mean, I would!
Kate
San Francisco, - Monday, March 31, 2003 at 19:47:15 (PST)
Thank you Dee! Doing happy Snape dance..errr...sorry! I'm sure Severus wouldn't
appreciate such outbursts. I'll try to regain some control. Now, what number Wench am I?
Off to the restricted section to bone up for the next quiz.
saturnine
- Monday, March 31, 2003 at 19:34:33 (PST)
Well, you know Carmen, there are plenty of uses for suspenders other than holding up
pants! :) I'm so happy you'll allow me visiting privileges, I'm sure I'll have plenty of
free time what with the other wenches being so busy with the wand polishing! And we all
need to be kept in line once in a while! (busily unpacking white nightgown...)
saturnine
MA - Monday, March 31, 2003 at 19:29:03 (PST)
Shanda--thank you so much--someone else has already scarfed it up!! I shall keep
checking. *sob*
Dee
- Monday, March 31, 2003 at 19:14:51 (PST)
If you want discipline, saturnine, then you've come to the right house. :) Loved
your slogan; I spouted tea all over the monitor when I read that! LOL And on another note
(sort of), I have always enjoyed Pedro's films. Especially "Tie Me up, Tie Me
down." Gee, I wonder why?
Carmen (Interrogator wench #1, twisted AND perverse!)
WA USA - Monday, March 31, 2003 at 19:00:23 (PST)
Love the website! To anyone who's looking for a copy of Closet Land, go to
www.secondspin.com. They have one vhs copy available and I highly recommend them, I've
shopped with them several times.
Shanda Minter <shandamint@yahoo.comfoo>
Gastonia, NC United States - Monday, March 31, 2003 at 18:49:11 (PST)
Saturnine, of course you are welcome, but could you try to get some points for the
House?? We are so busy polishing, we have avoided our studies . . .
Dee
- Monday, March 31, 2003 at 18:42:14 (PST)
I need to obtain a copy of Closet Land, and none appear to be available--seems to be
out of print. I will resort to Ebay (something I've never done before) unless there is a
kind soul out there who can lead me to a viable source . . .
Dee <ThankYouInAdvancefoo>
- Monday, March 31, 2003 at 18:39:40 (PST)
Sorry for the deluge of posts, I have about 10 more minutes before I have to get off
the laptop and get some work done. Re: Houses, would the Snape Wenches have room for a 33
year old apprentice wench who knows her place? You could banish me to the Interrogator
whenever you were otherwise occupied with polishing, unbuttoning, serving detention,
etc??? *waiting nervously for a reply...having flashbacks to the high school lunch table
hierarchy* ;)
saturnine
MA - Monday, March 31, 2003 at 18:38:27 (PST)
Dee- The Interrogator=Closetland=the man you love to hate in white braces! :) Okay,
now I can't stop thinking about suits, or buttons, or robes...Help! I forgot all about the
Sheriff's pants, must risk another dose of Costner and investigate further....
saturnine
MA - Monday, March 31, 2003 at 18:20:50 (PST)
Virginia, I know what you mean re: Closetland. I was afraid to watch it as well, but
now it's also a favorite. The subject matter is difficult, but for AR's performance alone
it's worth seeing at least once. I've always really been amazed by how his body language
and hands (don't get me started!) convey so much even when he's not speaking, and in this
movie it just blows you away. It's a very powerful character-he commands your attention
throughout.
saturnine
MA - Monday, March 31, 2003 at 18:13:31 (PST)
Thanks for the tip about New Idea, Aussiegirl!
I'm also sorry to inform you that there are/were three Almodovar movies on SBS this week, plus a special documentary: "All About Desire - The Passionate Cinema of Pedro Almodovar". This was on Sunday night, followed by his movie "What Have I Done to Deserve This?"
Here's a really good case of Alan broadening people's horizons. I had never heard of
this man before (yes I know NOW that he won an Oscar the other day, LOL), and I'm really
stretching myself by watching all his stuff. Alan can make a movie with Almodovar any time
he wants!
Gaye
Adelaide, South Australia - Monday, March 31, 2003 at 18:11:03 (PST)
Ella, Oh yes, you are number 5 aren't you!!
Deeeeeee
- Monday, March 31, 2003 at 18:00:29 (PST)
Snape Wench #5 (is that Cathy or CJ?) Perhaps you might go with the DVD/VCR combo??
I did that and kept my old VCR, now I can tape tapes (ahem) and watch DVDs!!
Dee
- Monday, March 31, 2003 at 17:59:27 (PST)
Tap-Ila, welcome to the PL House, and congratulations. You have just garnered your
House 10 points. (Snapes and Elyots, c'mon now . . . and Kit, there are no excuses).
Dee <SorryAli-PatYouAlmostHadIt!!!foo>
- Monday, March 31, 2003 at 17:57:38 (PST)
Troy08, Well, the VCR is free, but I'll take the DVD if you're buying ;-)
SeriouslyDeprivedEllawench
- Monday, March 31, 2003 at 17:55:38 (PST)
MA-"It's the suspense, not the pain that will drive you mad..", my
favorite line from the whole movie! I knew we east coast girls had good taste! :) My
second favorite being "..you've changed.." Well, now you've given me something
to think about-House of the Interrogator! I'm definitely not brave, but I am a bit
twisted. Maybe the slogan could be "It's the suspenDERS, not the pain that will drive
you mad!" We could just leave our respective houses for a little *discipline* from
time to time, I'm sure the Colonel wouldn't mind. Carmen, what do you think? :)
saturnine
MA - Monday, March 31, 2003 at 17:53:57 (PST)
Snape Wench #5-dump the VCR and get a DVD player. You will be SO glad you did.
Troy08
Lewiston, Me - Monday, March 31, 2003 at 17:44:52 (PST)
"By Grabthar's Hammer, by the Sons of Warvan, you shall be avenged!"
Submitted by the newest member of PL House.
Tap-Ila
also from Dayton, amazingly enough, OH USA - Monday, March 31, 2003 at 17:44:43 (PST)
Regarding clothes, I am suprised no one mentioned"Close My Eyes", he was very well dressed in that film, especially the morning suit he wore to the wedding. I too, am a fan of Hans Grubers clothes, and the Colonels uniform. Theres something about a man with a sword and sash hanging at his side. As for Snape, I love that bit of white linen shirt that peeks over his collar.
On the Private Lives tux-when he first appeared in it, I gasped out loud and said
"Ohh baby",as my brother sank lower in his seat. The lady behind me exclaimed
"what a hunk", as her husband sank lower in his seat!
Troy08
Lewiston, Me - Monday, March 31, 2003 at 17:42:26 (PST)
Must...stop...giggling...like a...madwoman!!!
I'm a disgrace to my house, I know. I haven't seen GQ, CL, CME, AABA, QDU, JK, JM, BD
or TMD (!!) and need to review the ones I have seen so I'll be up to speed. (I'm in the
process of acquiring a VCR to replace the one that just bit the dust.) *Hangs head in
shame and lops off to the dungeon to polish The Wand as penance*
Snape Wench #5, on her way now...
- Monday, March 31, 2003 at 17:41:06 (PST)
Okay, okay! I'll stand by my original post! (geesh--you're worse than my Latin II
teacher...)
Ali-Pat
- Monday, March 31, 2003 at 17:40:21 (PST)
In grading quizzes, I shall not take off points for misspellings, however, there
shall be no asking for clues. As we have already seen with Cathy, if you change your mind,
you may lose points.
Dee <TheTaskMasterfoo>
- Monday, March 31, 2003 at 17:38:31 (PST)
Or was it SUNS? But anyway, I'm sure about the hammer thingy.
Ali-Pat
- Monday, March 31, 2003 at 17:30:18 (PST)
Oops--did Lazarus also swear by the Sons of Warvan?
Hungry for points here.
Ali-Pat
- Monday, March 31, 2003 at 17:29:32 (PST)
"By Grabthar's Hammer, you shall be avenged!"
Ali-Pat
Dayton, OH USA - Monday, March 31, 2003 at 17:27:34 (PST)
You all really should be more serious. All this talk about clothes!! Hmmmph!!!
SWR <StodgyWetRagfoo>
Smallville, Anywhere - Monday, March 31, 2003 at 17:26:32 (PST)
Ella, alright--I know where my loyalties lie, I shall be faithful and true. I want a
personalized Snape too!!!
Dee
- Monday, March 31, 2003 at 17:24:21 (PST)
Pop Quiz 6: What did Dr. Lazarus say to Quelleck as Quelleck lay dying??? 10 points
to the House that answers correctly--and hit the books House of Snape (I'm disqualified
from answering!!)
Dee
- Monday, March 31, 2003 at 17:21:42 (PST)
Dee, I just realized, you're, ahem, "visiting" with Snape and George at *the same time*?!? And how are you managing that? Sorry, but I don't think Severus or George's ego would allow for that kind of kinky stuff.
House of Interrogater="Closetland"--the movie I would like to watch
eventually but am afraid to. (Not sure I can stomach AR as a torturer!)
Ella
- Monday, March 31, 2003 at 17:19:26 (PST)
Speaking of "the look" (I'm about to get my head bitten off, I know it...lol), has anyone, besides myself, noticed how snuggly AR gets with lovely young actresses during photo ops? No, really. I've noticed that he is very reserved, physically, in pictures with Emma T. and Rima, for example, but pair him with Salma Hayek, or some much-younger-thing-whose-name-escapes-me, and he's all bedroom eyes, sexy smiles and touchy-feely. (I really do hope I'm imagining that.)
Speaking of what The Man wears well, I'm a melted pool of jello when it comes to the Colonel and his *very* lovely red and white uniform. Ever notice how those white pants gently strain across his thighs? (Ooh hoo...wench alert!! lol)
Well, I must go and appease the other wenches. *Someone* (won't mention any names) has requested a "personalized" Snape pic. Heh heh heh. I'm on it! Cathy, I'll get your Snapes out to you tonight, and, GG, it's its_ellamentary "at" msn "dot" com (don't forget the little line thingy between its and ellamentary).
Dee, waaaaaah! I've got dibs on him tomorrow night!!! (I think George is Severus's
great-great-great-etc. grandfather. What do you think?) (!)
Ella <bringonthebuttons!foo>
pa usa - Monday, March 31, 2003 at 17:12:54 (PST)
Wait up--I don't know to what the House of the Interrogator refers!!! Little help
here??? Oooh, gotta run, Severus is impatient, and he's wearing the nicest frock coat and
cape . . .
Dee
- Monday, March 31, 2003 at 17:09:05 (PST)
Um, I didn't like Rasputin's rags very well . . .
Hey! the crossword puzzle is being crafted as I post here
GG--oh my goodness--George has buttons on his pants?? Okay, all you Snape Wenches back off--it's my turn now!! and I mean NOW!
I have not yet been able to see January Man, The Search for John Gissing, or Closet Land. Can anyone help me out here??? I might just have to go to Amazon.com and buy them all.
I can't even go to Toys R Us because my mother will think I'm stark raving mad!!!
Dee
- Monday, March 31, 2003 at 17:05:42 (PST)
My goodness!! I miss so much during the day! Fausta--I couldn't agree with you more
about Almodovar's films!! As I watched Talk to Her, I couldn't help thinking that the
majority of female characters (who started out strong) were rendered absolutely silent and
helpless and were basically thralls to the men in their lives (even in the [SPOILER] campy
silent movie part). I have not seen enough of his movies to judge him, so I will just
leave this comment as an observation of that particular movie.
Dee
Pasadena, CA Us - Monday, March 31, 2003 at 16:46:38 (PST)
Hi Aussiegirl, nope Iam going to win it! But if you do send me a postcard from
Australia house where they filmed bits of HP
Janine
Melb, Vic Australia - Monday, March 31, 2003 at 15:59:13 (PST)
Gwenn I have been very patient so pleaeeese plllleeeeeaaasee post more to your Redemption story. White Raven I have come to chapter 25 and now I am left waiting too so both of you please forget you have a life/family/job and write, write, write. Thank goodness I am only halfway through Snape in Love. Which of the Fanfics are completed? I need some closure in my fantasy life?
Gene Symond's the Kiss guy was in Melb recently and said in an interview he does
motivational talks. One of the things he says to people is that if you are an expert at
something make that something your career as when you want information about stamps you go
to a stamp expert and so following that logic I would say I hope you gals(excuse me if one
of you is a fella and I am wrong) put all this skill to good use and write your own
stories someday. I am looking forward to reading them
Janine (9.59 am April 1st) <janinels@optusnet.com.aufoo>
Melb (where the Newspapers/media always do an April Fools joke), Vic Australia - Monday,
March 31, 2003 at 15:55:35 (PST)
Also, thanks Fausta for your alternate view on Almodovar. I haven't seen any of his movies but will try and catch the one on Wednesday night and post my comments.
Just heard on the tele an ad for the release of HP2 on DVD and Video - says it contains 19!! deleted scenes. Do we dare hope any of them contain Snape as we were seriously duded with the movie (think I read it contained only 6 minutes of Snape)!
Also, Aussies - this week's New Idea contains a poster of HP2 and GUESS WHAT!!!!!!
SNAPES ON IT!!!!!! Now I've just got to figure a way of wrestling it out of my son's
hands! AND can it get ANY better *YES!* - there's a competition to win a $18,677.25 family
trip to LONDON! Don't bother entering though cause I"M GONNA WIN IT!!!!!!
Aussiegirl
- Monday, March 31, 2003 at 15:40:54 (PST)
Thanks Christine, glad someone else has noticed "that look" and I'm not hallucinating. I also noticed it in "The January Man" when they bundle the last lady into the storeroom to save her from the stalker. Do you think its an "acting thing" that he just does in roles or does he do it in real life. Any GBers who've met him like to comment - did you get "the look"? Don't be coy! Nathelie - we know you got a "double take" but was it coupled with "the look"?
Also loving the comments re : AR in a suit. Didn't see him in PL - has anyone got a
photo of him in the tux they can post? I'm sure he'd look great in a tux! And how on earth
did I forget him in Diehard - of course he looked fantastic in that well-cut Italian suit
(I'm sure I must do penance for that slip - any room in the dungeon Snapewenches?) I
suppose it had to be a cheap suit in Judas Kiss - if he'd turned up to work in an
expensive Italian suit they'd have thought he was "on the take". Haven't seen
any of the other movies he's worn a suit in - maybe one of the talented GBers could do a
montage of all his suit- wearing to settle this question for us!
Aussiegirl
- Monday, March 31, 2003 at 15:33:34 (PST)
Aussiegirl - re: Judas Kiss and "THAT LOOK" he sometimes gives women...
not your imagination at all. He looks at her face, then the eyes drop to take in a
"lower view", then come back up. Mmm, nice. Did you notice that Emma's character
in Judas Kiss does the same thing, looking at him? And I swear that PL even does it to
Rose, the theater manager (is that her name?) during his entrance scene in An Awfully Big
Adventure. Some guys just can't help themselves.
Christine
USA - Monday, March 31, 2003 at 13:51:40 (PST)
I'll join the house of the Interrogator. I bet I'll get HIM all to myself! (unless
MA was proposing to join too). Don't worry about me, I'm a masochist. (heh) What's the
quiz question for today? I want to play!
Carmen
WA USA - Monday, March 31, 2003 at 13:29:52 (PST)
Ali-Pat, I am definately with you on the "tux" thing. To me, there is nothing finer than a tux, except of course, AR in a tux. That scene in Private Lives alone promised me a happy life.
Carolyn dear Carolyn, can you e-mail me please! Sorry, my e-mail is being a weirdo and
I can't get into my addy book.
JC
Auburn, AL - Monday, March 31, 2003 at 13:26:07 (PST)
Georgiana--it was Jenny Beaven, costumer for Private Lives, and I'm pretty sure she said "garbage bag". (Immediate visions of "making do" with such an item in the rain at a holiday parade...)
And you are right about that tux. I had a front row seat on the Elyot side of the
theater the first time I saw PL, and I nearly slid to the floor in an ecstatic
faint when he leaned on the bannister with his back to the audience during the first act.
Yes, he can certainly wear a suit!
Ali-Pat
Dayton, OH USA - Monday, March 31, 2003 at 12:45:53 (PST)
Thanks GG for admitting such an atrocity as entertaining the idea that KC has been in something worthwhile. I happen to like a lot of projects KC has been in. While Body Guard is not one of them, I have to admit that I did like Silverado, Bull Durham (my fav), Field of Dreams, Dances With Wolves, The Untouchables, and the list could go on. Despite his childish behavior (and obvious blunder in undertaking the project in the first place) with RHPOT, I still like his work. I mean he is (like everyone) entitled to make a few mistakes.
Awwww, the good ole days....RHPOT was my first taste of Rickman. I remember thinking
"I gotta find out more about this guy!" He had already caught my Mother's eye in
Die Hard so she's the one that told me his name. The rest is history!
Claudia
GA US - Monday, March 31, 2003 at 12:23:41 (PST)
Ella, just had an email to you returned to me as mailbox unavailable. Can you repeat
your email ad. Thanks GG
Gissing's Girl
UK - Monday, March 31, 2003 at 12:07:28 (PST)
On clothing - don't forget that cute altar boy thingie in Michael Collins!
I.M. Lurking
US - Monday, March 31, 2003 at 12:02:39 (PST)
Dee, I've just twigged why you want to visit the HoN, you naughty girl, I hope your poor Mom has gone home and doesn't have to see the depths to which you have fallen.
On a different tack I love to see PL in the green sweater in AABA and the frock coat in the duelling scene in HPCoS.Snape wenches unite we need some points or we will all be in trouble with the PM.
I had a horrible thought --- I actually liked KC in The Bodyguard. For that I should be
incarcerated in the dungeons until I repent.
Gissing's Girl <Buttonsaremynewhobby@snape.comfoo>
UK - Monday, March 31, 2003 at 11:50:16 (PST)
Suits, boots, buttons, and yes, even a 'stache! The Man goes well (and sexy) in
anything and EVERYthing!
Claudia
GA US - Monday, March 31, 2003 at 11:35:04 (PST)
I should be working! Instead I'm thinking about AR in a suit. Oh my God. That's what
did it for me -- Hans's suit (and trench coat) in "Die Hard." AR looks amazing
in that black suit near the end of Dark Harbor too. Actually, he looks better in it than
out of it. (But let's not start...) I think AR is one of those men who looks more naked
when he's fully dressed in a good suit than when he's naked. And on another sartorial
note, I think I figured out the subtle psychological reason why so many of the
Snapewenches seem equally attracted to the Sheriff. It's the BUTTONS! Did you see how many
he had on his pants at the end of RHPOT?
Kate
San Francisco, - Monday, March 31, 2003 at 11:10:40 (PST)
Wail! House of Elyot will never get any quizz points unless you read my mind and
know what time of day I'll be on line! My daughter "uses" the account MANY hours
a day so I just squeeze on when I can. AR clothes: I love the football sweater he wears in
AABA, the pajamas and tux in Private Lives, the blazer in Dark Harbor (the outfit after he
took off the blazer), the suit in Dogma, Snape in cape or out, that snazzy suit in Die
Hard, and the oversized topcoat he wears in TMD. Ok , everything he puts on looks fine to
me. I especially love his footwear in act two of Private Lives...none! and the undershirt
in AABA,the hat in S&S,the cape in Mesmer, and, I'll stop now, I'm breathing hard.
kit
pa usa - Monday, March 31, 2003 at 10:54:07 (PST)
This is so weird and I am so excited that I hope you'll forgive the very tenuous
link to AR. I just got an email that there's a new chapter up on "Dreaming's Not A
Crime." The author mentioned that her grandmother from Venezuela is visiting, and I'm
almost as chuffed about that as the fanfic! My grandfather was from Venezuela and I almost
never come across anyone else with family ties there. I'm Irish and Venezuelan, a rare
mix...
Carolyn, dear Carolyn
CO USA - Monday, March 31, 2003 at 10:50:25 (PST)
Don't like him in suits? Oh my! Wait until "John Gissing"--finally in a
suit that fits! But, a bit snug around the middle or not, he was absolutely lush in that
tux in "Private Lives," which prompted the costume designer to say he'd look
grand in--what was it?--trash bin? sack cloth? Can't rightly recall, but certainly I
second the sentiment.
Georgiana
Seattle - Monday, March 31, 2003 at 10:23:16 (PST)
Ali-Pat: Thanks so much for the link; THAT was the article I was thinking of. Oooh
speaking of which,just thinking of Alan's reputed "stamina" raises my
temperature a few degrees....
Virginia, a Rickmaniac
NYC, - Monday, March 31, 2003 at 09:50:53 (PST)
Dee said: "Rowling has created such an odd character in Snape (i.e., evil on
the outside but so good on the inside) that I do not believe typical morality will play a
role in his outcome (I guess I just don't want him to die!!)." All I can add is: From
your lips to Rowling's ears!
Virginia, a Rickmaniac
NYC, - Monday, March 31, 2003 at 09:37:18 (PST)
Actually, I got my husband to sit through a Rickman double feature (his first!) the
other night. We watched Closet Land followed by Truly Madly Deeply... hmmm, quite a study
in contrasts. Well, he agreed that he's a terrific, fascinating actor and maybe now
understands why I have Rickman wallpaper plastered on my computer screen. (Evil grin!) As
a matter of fact, he and my daughter were were at her children's theater the other night
and he was talking to her director about Rickman's films. He couldn't remember his name
(can you imagine?) and called out to my daughter: "Honey, who's our favorite actor
again?" to which she rolled her eyes as only an 11yo can and replied, "His name
is Alan Rickman and he's MOM'S favorite actor, not OURS!" Hee hee, I gotta work on
her some more, I guess!
Virginia, a Rickmaniac
NYC, - Monday, March 31, 2003 at 09:30:20 (PST)
Dee, we CdC,GG, CJ, Ella andI won't kick you out although you might have to forgo some of the more homely pleasures like detentions and wand polishing if you want to make out with George. After all I have made a huge sacrifice and given up PL and are now hopelessly devoted to the Potions Master. This man is costing me a fortune what with Snape figures, Tshirts, Mugs and now Poster books. That reminds me, I must go to Woolies tomorrow and buy a book before the kids snap them up and there's non left. Perhaps I could bribe a child to give me the Snape picture.
CdC hope youv'e recovered from the dance class and are not teaching it to you know who.,
Janine did the email get through?
Gissing's Girl <snapedmorningnoonandnightfoo>
UK - Monday, March 31, 2003 at 09:26:02 (PST)
Saturnine said: "Please Kate, no more Costner! Have mercy on me! I watched
RHPOT again today, too. That makes three times this week. If it wasn't for the Sheriff, I
would have put my eyes out." HAHAHAHAHAHAHAHA OMG you are sooooo right about
that!!!!! And oh, Closet Land! I don't know why but I went from dreading, to liking, to
loving this film... am I sick or what? Yes, you gotta hate his character but he's sooooo
fabulous in this, and best of all, Costner isn't in it!! LOL
Virginia, a Rickmaniac
NYC, - Monday, March 31, 2003 at 09:22:59 (PST)
Taking a break from work and getting caught up reading the GB from this weekend. CLOSETLAND is one of those movies that needs to be watched more that once to fully understand it. The movie's subject matter is not nice, the performance that AR gives in the portrayal of his character's "personality's" is well worth the watch.
Well break is know over and time to get another movie in and get back to work. Everyone
have a great day!!
Tina
Chicago, - Monday, March 31, 2003 at 09:13:08 (PST)
CdC - thanks :) sigh. And here I thought my age would help. Oh well, I guess I'll
just have to be one of the younger hot sexy wenches (in my wildest imaginations
CJ
- Monday, March 31, 2003 at 08:58:12 (PST)
re: Almodovar's ¿Qué he hecho yo para merecer esto?!!,
either the reviewer didn't watch the film, or a great deal was lost in translation. Having
watched it in the original Spanish, it's definitely not an ode to women, unless it's an
ode to women who pimp their children.
It's a sad comment on our modern lives that Almodovar's films are considered "odes
to women". They are as much of an "ode to women" as is the more ridiculous
feather-in-the-nose couture.
Fausta
- Monday, March 31, 2003 at 08:28:37 (PST)
Virginia: Thank you for posting the interview link! I am also fascinated with the rickmanisms in Closet Land. Creepy as the movie is, I really listened closely the second viewing for word-plays and appreciation of the menace that AR put into the character by his bodily craft. IMHO this is his most polished performance; that is, with the qualifier that I have seen neither all of his movies nor his stage work.
Saturnine: Thank you for mentioning the wardrobe in Closet Land. I can justify noticing it with a few pithy erudite arguments, but you and I (and everyone else on this GB) know it has more to do with eye candy.
Oh Dee! I have gotten so good at knowing what time it is in London that it is embarassing! Isn't that sad? Please, please get your mom to do the crossword puzzle for us. I do lots of them; I figure it's good exercise for my aging brain. Also, I was wondering if we couldn't kidnap the Head of HoN and chain him up in the dungeon for a while. That way, you wouldn't get caught sneaking out--see, I'm always looking out for your welfare! The other benefit is that he would get away from KC AND his dim bulb of a henchman!And I'd be willing to, um, stimulate his mind so he wouldn't get bored.
CJ: Far as I can tell, it's Gissing's Girl, me, Dee, and then you. Patience.
Carolyn, dear Carolyn <rbrlubber@aoldotcomfoofoo>
CO USA - Monday, March 31, 2003 at 08:23:25 (PST)
I'm sorry, it' Tele 5! (32 Channels is simply too much for me:))
U
Germany - Monday, March 31, 2003 at 08:19:56 (PST)
To all Bavarian Rickfans!
"Bob Roberts" is on TV 5 tonight, 20.15 !!!
Ulrike
Germany - Monday, March 31, 2003 at 07:06:28 (PST)
Ella - sorry for the delay - I don't have email on weekend :( As for my age???? I'm
42 - am I the the oldest and therefore get the most respect in 'House of Snape?"
pleeezzze??? P.S. Sometimes it's nice in today's world to just get away and enjoy the
silliness. I have a business and lord knows I need a little 'escape' time now and then!
CJ
- Monday, March 31, 2003 at 06:26:10 (PST)
To Kate and Carolyn and anyone else who was wondering about AR's input on RHPOT,
according to Paton's book he and Peter Barnes wrote a lot of the Sheriff's extra dialog
while having lunch together one day, and the article that appeared in the 8-9-91 Entertainment
Weekly ("A Tough Actor to Follow"), states that the leg-splitting acrobatics
in the rape scene were his idea. You can find this, and many other fine articles, on
Suzanne's Articles page (see the Home Page).
Ali-Pat
Dayton, OH USA - Monday, March 31, 2003 at 05:51:48 (PST)
Oops, and a little something else . . .
There was a request for some Snape fiction, without the more, um, explicit qualities. Hie thee to www.sugarquill.net and inspect the works of RJAnderson. She's written an excellent Snape trilogy called Darkness and Light with the stories in the following order:
The Potions Master's Apprentice
Personal Risks
If We Survive
There are other works of hers at Sugarquill, too, and she's busy on more Snape material at the moment. Right now, Sugarquill is my favourite site for HP fanfiction. Enjoy!
MA
- Monday, March 31, 2003 at 05:20:12 (PST)
Greetings to "Saturnine MA"--we MA's have to stick together, but in this case, I'm afraid I'll have to be sorted into the House of the Colonel. 8-) However, I started thinking (after your comment about The Interrogator's white shirt and braces) that no one to my knowledge has been brave enough or crazed enough yet to start a "House of the Interrogator." =8-O I imagine the House symbol might be a pair of pliers? And there are any number of possible slogans . . .
MA (the original)
"It's the suspense, not the pain, that will drive you mad", USA - Monday, March
31, 2003 at 05:14:26 (PST)
I will have to say Judas kiss is not on any of my fav movie list. It was like they were making a few different movies and splices them together.
Carolyn dear carolyn thank you for the postcard I shall try and be so cleaver
janine
Mel, Vic Aust - Monday, March 31, 2003 at 02:44:46 (PST)
WELL....!!!! Its been a LOOOOONNNGGG time since I peeped into this (or any!!!!!)
part of cyberspace!! Blame a torturous, mind boggling, horrifying but utterly necessary
phenomenon called exams. But they're over...and that what counts!!!! Unfortunately, wasnt
able to keep up with the GB. So will just lurk for a while......until the archives are
fully read. Pl. bear with me!!!
Shloka Vadialingam <justshloka@yahoo.comfoo>
India - Monday, March 31, 2003 at 01:58:28 (PST)
Dee- Lucky wench, indeed! hee hee! But I'll share, no dishwashing for you. But maybe
if you could bring your Snape doll for a visit? I can't find one anywhere out here. Any
suggestions? What's the consensus? Is Snape with Snake the one to be hunting for? I just
don't think the shopping gods are with me, I can't find the thongs either! Very sad.. And
now it's time to slip into an AR induced coma, too much TiVo excitement and talk of
suspenders for my own good.
saturnine
MA - Monday, March 31, 2003 at 00:15:34 (PST)
Please Kate, no more Costner! Have mercy on me! I watched RHPOT again today, too.
That makes three times this week. If it wasn't for the Sheriff, I would have put my eyes
out. Re: Judas Kiss, that meat locker scene definitely made me reconsider the whole
vegetarian thing, and abstinence! :) But, I have to say that I just love him in a suit. My
absolute two favorite "suit moments" are when he's standing by the window at the
start of "Fallen Angels" and basically all of Closet Land. Those trousers, white
shirt and suspenders just do it for me every time. Why do I suddenly feel cheap??? And I'm
a *big* fan of buttons! My favorites for Snape were during the dueling scene minus the
robes, and actually during the Quidditch match in HPSS with the scarf and the fingerless
gloves and coat. Okay, I'm definitely overtired! And cheap, cheap, cheap! :) Anyone else
have any wardrobe "preferences?" Or should I say fetishes?
saturnine
MA - Monday, March 31, 2003 at 00:00:54 (PST)
Dee - its 5.30pm Monday night here so this will have to be my last post - got to dish up dinner to the kids. You should get one of these time thingys - real name "Seiko World Time Voice Alarm". A very cultured English woman tells you the time when you press a button. Got it to keep track of DH when he globe-trots.
Discovered a fun site ages ago before I discovered the GB(was that only 3 months ago -
don't know what I did with my life before that!) so don't know the web address but will
try and find it when I've got a minute. It was some guy who used a Snape doll to show
scenes from little stories he wrote. I think it was "Snape as a Kindy teacher".
I stumbled on it from the official HP site I think. Someone may know the address. However,
with so many GBers now owning their OWN Snape dolls, someone might like to do their own
little site. I think, however, that the "Snape Wenches" might come up with only
X-Rated stories (with dolls of themselves included!)
Aussiegirl
- Sunday, March 30, 2003 at 23:43:06 (PST)
Dee Have fun with ole' George..Im in detention for getting the wrong answer on the
quiz...I have been really bad!..."oh what was that Master?..oh you need your wand
polished?..ok be right there"...Gotta go! The Master is waiting!...
Cathy in The House of Snape <IneedadetentionwiththeMaster@snape.comeherefoo>
FL USA - Sunday, March 30, 2003 at 23:42:39 (PST)
Saturnine--I can't believe it!! Lucky Wench!! Houses are open, join up! Keep lurking
about the GB--I'll be in MA in June. I may have to stoop to doing dishes!!
Dee
- Sunday, March 30, 2003 at 23:26:22 (PST)
Kate, I'd like to say *bloody* brilliant, okay?
GG, CdC, Ella, Cathy, CJ--you won't kick me out will you?? I am so devoted to Professor Snape, but, but, but, George needs company (what with being bored to death by Kevin Costner all day long). You will forgive me?? Won't you???
Virginia (talk about Snape wenches), Rowling has created such an odd character in Snape (i.e., evil on the outside but so good on the inside) that I do not believe typical morality will play a role in his outcome (I guess I just don't want him to die!!).
Yes Aussiegirl, I was thinking when you wrote that post that it was only 10:00 p.m. here. I often wonder what time it is around the world for different GBers!!
Dee
Pasadena, CA US - Sunday, March 30, 2003 at 23:23:49 (PST)
It's now 2:00 in the morning here, and I should be sleeping, but I'm busy gloating
over my TiVo!!!!! Yipeee! The husband caved in and surprised me with it. So, I'm busy
setting up my wishlist: AR, AR, AR! DEE- if you're still up for a visit, we're all set.
(No dishes) Are the houses still taking new members or are they full? By the way, I found
a really funny fanfic: http://www.fanfiction.net/read.php?storyid=815796 "Albus
Dumbledore's Inbox" featuring many irate emails from our favorite potions master
throughout, as well as a grudging "questionnaire" response in Ch. 5. Pretty
good, especially if you're a general fan of the HP series. However, not half as amusing as
all of the "wand polishing" exploits of our own Snape Wenches. :)
saturnine
MA - Sunday, March 30, 2003 at 23:17:37 (PST)
And that last link really works! DEE: I am a NY Times crossword devotee! I have
probably done many of your mom's puzzles. I am so impressed! I can't believe I'm saying
this but, I just watched RHPOT for like the second time in three days. (DH is on a
business trip. What can I say?) That movie does not get any better. It doesn't get any
shorter either. If only AR wasn't so funny and insane rock star gorgeous in it ...
Kate
San Francisco, - Sunday, March 30, 2003 at 23:08:00 (PST)
CdC what is this about split loyalties, I'm Sevy's forever! especially since last night in the potions lab. Amazing what you can do with some of those potions.
Dee thongs with Sevy on them, same address, CafePress, go onto their site for a
picture. We need some questions for the HoS so we can catch up or it will be MORE
detentions. Can't bear the thought of that can yoy.
Gissing's Girl <foreveraddictedto sevyfoo>
UK - Sunday, March 30, 2003 at 23:02:21 (PST)
Brilliant Kate! That one works! Must learn how to do that myself one day!
Aussiegirl
- Sunday, March 30, 2003 at 22:57:46 (PST)
Sorry sorry sorry. I gotta stop doing HTML because when it comes to computers I;m no
Ed. Here is the link to
Painting with Light stills
Kate
San Francisco, - Sunday, March 30, 2003 at 22:55:43 (PST)
Kate, couldn't get that link to work.
Aussiegirl
- Sunday, March 30, 2003 at 22:55:02 (PST)
Grrr Aargh. Screwed up that Painting with Light link. This is it Stills from AR Painting with Light
here
Kate
San Francisco, - Sunday, March 30, 2003 at 22:51:14 (PST)
GML, I've never seen still pictures of the TCM painting with light piece, but would
like to see them if they're online somewhere. I know I've seen the poster Alan Rickman did
for Antonio at the Rickman in the Round site, which has a lot of other neat things, too.
sonoma
usa - Sunday, March 30, 2003 at 22:41:16 (PST)
Dee, yes the Goblet of Fire led us to believe that that's exactly what Snape is
doing/about to do (i.e., infiltrating Voldemort's forces as a spy), hence all the fan
fiction! But I still think he may get killed off, as the typical morality ending. The
other ending is to dangle Snape within the jaws of death and, as you mentioned, have Harry
save him. (Though Harry may be too busy saving Hagrid or Dumbledore or ?) I'm trying to
find that website for you where I read the Rowling info. On it the article states that she
handpicked Robbie Coltrane and Alan Rickman for their roles and worked with them,
revealing their future character developments. The interviewer asked Coltrane if he would
share some spoilers and he replied, "Sure, but then I'd have to kill you" or
something like that.
Virginia, a Rickmaniac
NYC, - Sunday, March 30, 2003 at 22:15:15 (PST)
And Dee - my clock thingy says its 10pm in California! Its great - you just press a
button and it'll tell you the time anywhere in the world! Of course it doesn't factor in
Daylight Saving time and stuff like that.
Aussiegirl
- Sunday, March 30, 2003 at 22:11:43 (PST)
Hi, I was wondering if somebody here has or knows where I can find a still (web-based) picture of the giraffe, Jimmy Stewart and a picture of the self-portrait poster (I forget what the play was) Alan made a while ago. Just wanted to email them to an artist friend who's curious and I can't remember where to find them. Can't remember if Suzanne or Claire or Claudia have them on file (so many)....
GML
UK - Sunday, March 30, 2003 at 22:09:12 (PST)
Dee - didn't realise I'd won 10 points! You'd think someone else would want to join the House of Jamie even if its just because we're leading the points table!
I don't have a DVD but that longer "Potions Class" scene was included at the
end of my kids' video. Can't believe they cut that scene - its the best in the whole
movie!
Aussiegirl
- Sunday, March 30, 2003 at 22:07:38 (PST)
Cathy--sorry, no points for trying at this time. You must study harder. (And get
through to Ella!!)
Dee
- Sunday, March 30, 2003 at 21:58:43 (PST)
Don't you people ever sleep? My international clock thingy says its 1am on USA East
Coast - GO TO BED!
Aussiegirl
- Sunday, March 30, 2003 at 21:58:01 (PST)
Ay Caramba! There are TWO Pedro Almodovar films on Aussie free-to-air TV this week! Sorry, but the first was last night "What have I done to deserve this?" so we've missed it, but the second is Wednesday night at 10pm on SBS. The reviewer gives it 4 stars and says "Spanish director Pedro Almodovar had been churning out kitschy comedies for years before he hit international paydirt (read lots of awards, including an Oscar) with this ripper. It's a strange tale centred on a grieving mum who heads back to her cross-dressing mates after her son is killed. There's also a pregnant, HIV-afflicted nun and a flat full of garish wallpaper, but it is a gentler, less flashy picture than Almodovar's usual fare. It's his ode to women (all his films are when you think about it) and probably his best work to date."
I thought the comment about all his films being "odes to women" was
interesting. AR has stated that his own upbringing gave him a respect for women (isn't
this why we admire him??) and so I imagine this could be a reason why he admires
Almodovar's work.
Aussiegirl
- Sunday, March 30, 2003 at 21:54:09 (PST)
Re: RHPoT, okay this interview doesn't specifically mention the rape scene, but it
does discuss Alan's adlibbing throughout the film.
http://www.btinternet.com/~sc.i/nice_guy.htm
Virginia, a Rickmaniac
NYC, - Sunday, March 30, 2003 at 21:50:58 (PST)
ELLA--ELLA ARE YOU THERE???!!! Oh my goodness--those HoS graphics are so FABULOUS. I
am still laughing. Do I have your permission to save them to my hard drive?? I promise not
to make any money off of them!!! Please keep them coming!!
Dee
- Sunday, March 30, 2003 at 21:48:41 (PST)
Virginia, my only hope is that Snape may be redeemed (and his death thus avoided) by
inflitrating back into the Death Eaters as a counter-spy for Dumbledore, and putting
himself at serious risk for the sake of saving many. Of course, I think Harry will have to
save Snape. Gosh, I hope so!!! Where did you read that about Rowling??
Dee
- Sunday, March 30, 2003 at 21:42:36 (PST)
First off I have to say I gave it my best shot in answering the fisrt question..Im
so ashamed for thinking it was "E" Major..I was sooo close! Do I get credit for
trying? hint.hint..***ELLA** I have tried 2 times to email you, it keeps bouncing
back..can you email me? snapefan2@aol.com (no foo)!! lol..
Cathy from House of Snape <Snapefan2@aol.comfoo>
FL USA - Sunday, March 30, 2003 at 21:40:28 (PST)
that's "kids"
Dee
- Sunday, March 30, 2003 at 21:32:35 (PST)
Kate--most excellent catch there in the NYT puzzle!! My mother actually is a crossword puzzle creator (has had puzzles in the NY Sun, NY Times, LA Times, and USA Today). I will get her to make us all an AR crossword puzzle!!!
Denise--you lucky thing you!! I shall watch TMC constantly now!!
Aussiegirl, sure you meant when your "kid" were watching Spy Kids!! :)
Oh, yes, and I must add that Ella, Cathy and CJ are vying for the professor's attention too, which are three more good reasons to join up with the Sheriff now and then . . .
Saw Talk to Her tonight--I am ready for AR to be in an Almodovar film NOW.
Dee
Pasadena, CA USA - Sunday, March 30, 2003 at 21:31:48 (PST)
Dee, your post from earlier this week mentions your thoughts on the possibility of
Snape dying a hero's death in the future. That's exactly what I see happening in the 7th
book (though I hope I'm wrong). Aaah, I'm conditioned to think that former Death Eaters
would have to redeem their earlier sins and what clearer redemption than through honorable
death? I know I've read that Rowling has worked closely with Rickman and Coltrane,
revealing future plot spoilers for their 2 characters so something big's gotta happen with
Snape and Hagrid...
Virginia, a Rickmaniac
NYC, - Sunday, March 30, 2003 at 21:31:02 (PST)
Okay, here is the current point distribution for the various houses (Thank you Ella for your excellent House records):
House of Jamie: +10 (Aussiegirl--correct answer to Quiz 2)
House of Nottingham: +5 (Juliana--correct answer to Quiz 1)
House of the Colonel: +5 (Kate--correct answer to Quiz 4)
House of P.L.: +5 (Ali-Pat--correct answer to Quiz 5)
House of Phil: -5 (Amanda--correct answer to Quiz 3--but then changed her mind and got it wrong.
I would like to note that the House of Snape and House of Elyot are sorely behind with
0 points!! (At least the House of Phil is trying!!!)
Dee
- Sunday, March 30, 2003 at 21:25:36 (PST)
Hahahaha, yes Kate that's all we need... MORE Costner footage (huge groan). I'm sure
I also read in an interview somewhere that Alan came up with the funny spread eagle 'rape'
scene. I'll bet he adlibs or rewrites for films all the time... certainly there were wry,
unexpected Rickman-isms all over the place in Closet Land, for instance, that I can't
believe were not his own.
Virginia, a Rickmaniac
NYC, - Sunday, March 30, 2003 at 21:18:02 (PST)
I meant when my kids were watching Spy Kids!
Aussiegirl
- Sunday, March 30, 2003 at 20:55:45 (PST)
Also - re :Judas Kiss. Definitely not my favourite AR movie. What's wrong with it -
Firstly, HATE him in that suit. Don't know if it was badly cut or if I just don't like him
in suits. Definitely prefer him in frock coats, or just casual clothing. Also, thought the
porno film within the film was just gratuitous and as for the "sex on the meat
hook" scene - put me off both steak and sex for a couple of weeks! The accent was
interesting but prefer his English accent. What's good with it - THAT look he gives Emma
T. when he first sees her at the police briefing. Did anyone else notice it, its only
fleeting but classic AR - THAT thing he does with his eyes when looking at some women (or
is it my imagination?. Also his banter with Emma is just great. Also, he has a little
daughter in this movie (although he is estranged from her mother). This is the only movie
I've seen him in where he has a child or even interacts in a NICE way with a child. The
plot has a good twist also. The girl in it I noticed in Spy Kids when they were watching
that and Simon Baker-Denny is an Aussie.
Aussiegirl
- Sunday, March 30, 2003 at 20:54:11 (PST)
Its a bit lonely here on my own in the House of Jamie - can I tempt anyone to join
me - Janine, you interested? - I've even won 5 points already.
Aussiegirl
- Sunday, March 30, 2003 at 20:43:08 (PST)
NY TIMES SUNDAY CROSSWORD PUZZLE, March 30: 102 Across -- "Harry Potter's
potions professor" Hmmm, what could the answer be?
Kate
San Francisco, - Sunday, March 30, 2003 at 20:31:57 (PST)
Hi Dee, Havent had a chance to get back on until now. Hubby is snoring away and my
son is sleeping after watching Harry Potter again for the millioneth time!! (It is SO
good) Cant wait for the new movie to be released in a week or so. I ordered my copy from a
company called Strawberries (a music store) and you also receive a free copy of Tom
riddle's diary. As for the Sheriff figure, I bid on it on Ebay auction site. They always
have them. Do a search under Sheriff of Nottingham and you will find them! Good Luck. I
also found my copy of Mesmer on the Barnes and Noble website and is being shipped out now!
Cant wait. I havent checked tonight on Ebay to see how many bids are on that Pillowcase
with AR on it. I also noticed on Ebay, they have a tote bag with AR's photo on it too!!!
See you all later-Ebay here I come!!! Have a nice evening everyone Pam
Pam <sholman@tmlp.comfoo>
Norton, MA USA - Sunday, March 30, 2003 at 20:20:45 (PST)
Ella, my dear, he's all yours tonight! I am going to find a place to hide--maybe
that linen closet isn't such a bad place after all--and sleep the sleep of the righteous.
Quit snorting, Dee! I can be righteous if I want to!
Carolyn, dear Carolyn
CO USA - Sunday, March 30, 2003 at 20:16:57 (PST)
CDC, Ahhhh, yes. Of course we both happened to be on the good prof.'s agenda last night ;-) (Hee hee...you'll find out what I'm referring to sooner than later.)
Just try and tell me that AR doesn't have a subversive sense of humor! (!!) You know,
it was either in one of the first interviews I read, or an article on RHPoT, back when I
was first bitten by the AR bug (that tidbit sort of did me in!), which was well over a year ago. I *cannot*, for the life of me, remember where I read it....sorry :-( If ever I
come across it again I'll be sure to send you a link.
Ella, wondering where she falls in the good (ahem, *fantastic*) professor's schedule
tonight. (???)
pa usa - Sunday, March 30, 2003 at 19:17:29 (PST)
Thanks for the info on the RHPOT DVD Virginia. I also read somewhere, can't remember
for the life o' me where, that the "look at me, I'm a tripod" business in that
"rape" scene was all Alan's idea. He felt the scene was too "heavy"
(can't remember his exact words) and didn't fit with his comical interpretation of the
Sheriff, so he came up with the pushing her legs apart with his feet thing. Oh, the mind
reels wondering how he figured out how to do THAT. I also read somewhere that he ad-libbed
a lot of his lines, with the help of Ruby Wax ("You, my room, 10:30 tonight..."
sure sounds like a Rubyism). And you're right, the extra footage on the DVD will probably
be all Kevin. He'll probably throw in home movies of himself as a baby. Maybe if we;re
really lucky, outtakes from "Dances with Wolves" too!
Kate
San Francisco, - Sunday, March 30, 2003 at 19:12:47 (PST)
And, how did you find out AR wrote thatscene? Hard to believe I missed
reading one jot or tittle on this particular subject!
Carolyn, dear Carolyn
CO USA - Sunday, March 30, 2003 at 19:02:44 (PST)
Dee, I didn't see your comment about keeping score; way to go, sister wench!
I have Dee and Carol's e-mail addresses and will be sending them goodies tonight. So, GG, C.J. and Cathy, drop me a line at its_ellamentary "at" msn "dot" com if you'd like some goodies too. (Finished the House of Snape coat of arms and was having so much fun I tinkered with it to death...and so you have 8 different versions to choose from. Also, made some wench-themed Snape graphics using movie pics and cartoon bubbles.) (I'm hiding my design software now before I hurt someone.)
Ella
pa usa - Sunday, March 30, 2003 at 19:02:06 (PST)
"Ella, knocked-down-and-dragged-out-tired from her late night rendevous with the prof. ;-)"
Hmmmm, maybe it wasn't the pelvic rocks and shoulder shimmies at dance that have
me wiped out...
Carolyn, dear Carolyn <gonnasmirkthewholetimeI'msoakinginmyhotscentedtub!@upstairsndownthehall.comfoofoo>
CO USA - Sunday, March 30, 2003 at 19:00:00 (PST)
Kate, Sorry I didn't get back to you sooner but I've been out all day. I have RHPoT
on an o-l-d videotape and was looking to finally upgrade it to DVD so was searching at
buy.com and that was where I initially noticed that a Special Edition was available for
pre-ordering (out on June 10th apparently). Then on a Google search I found a few sites
where the additional content was mentioned. One site (sorry can't remember which one right
now) mentioned that the additional footage was of Kevin Costner - naturally! - but I'm
hoping really hard that Sheriff George's scenes that ended up on the original cutting room
floor will be restored. (Though if Costner has his way, it's probably doubtful... but you
never know!)
Virginia, a Rickmaniac
NYC, - Sunday, March 30, 2003 at 18:53:38 (PST)
All this talk about the Sheriff is giving me pause...I think I may have to don my skimpy peasant's outfit and mosey on over for a visit soon. (Loooved the comedic "rape" scene! AR earned my eternal respect the day I found out that he *wrote that scene*!!!)
Kate, uh, I haven't been keeping track of points and trying to dig through the board to get caught up would cause me to pull my hair out (and goodness knows the good professor is into hair...gotta keep it nice and bouncy so we can run our hands through each other's lovely locks, you know).
I have a current list of houses and members, however:
House of Snape: CDC, GG, Dee, C.J., Cathy, me.
House of Phil: Barbara and Amanda
House of PL: Ali-Pat
House of the Colonel: Kate, Susan, Nathalie, and Zoe
House of Elyot: Kit
House of Jamie: Aussiegirl
House of Nottingham: Sara and Juliana
Ella, knocked-down-and-dragged-out-tired from her late night rendevous with the prof. ;-)
pa usa - Sunday, March 30, 2003 at 18:47:46 (PST)
Hello Im Joanna Frakes from Colorado.Im 13 years old and a big fan of Alan Rickman.
Joanna Frakes <
Loveland , Colo. U.S. - Sunday, March 30, 2003 at 18:38:31 (PST)
RIMH was also sung by Ringo... That's got to take the prize!!!
Julia
Calgary, Canada - Sunday, March 30, 2003 at 18:20:38 (PST)
Dee, or anyone else who's interested for that matter. Mesmer is usually available at
www.videoflicks.ca (sorry, can't make links) for about $18.00us plus s&h for the dvd.
Denise
B.C. Canada - Sunday, March 30, 2003 at 18:11:10 (PST)
Raining in My Heart was also sung by Leo Sayer. Any points for that?? LOL!
Leanne
- Sunday, March 30, 2003 at 16:40:16 (PST)
Dee: Ali-Pat is indeed correct on the TMD answer.
Kate
San Francisco, - Sunday, March 30, 2003 at 16:27:34 (PST)
Earlier this evening, I was watching the Turner movie channel. In between movies,
suddenly, THERE HE WAS! AR was waving a light wand in the air and talking about how
wonderful an actor Jimmy Stewart was. In the air, he drew with the light wand a portrait
of Stewart, a giraffe, and the words 'simple' and 'true.' All together it was probably
only about a minute, but he was speaking with The Voice the whole time. No mention of any
of the roles he has been in or anything like that. He did introduce himself at the start
and said again at the end that he was Alan Rickman. No idea if this was a one off or a
regular feature. Way cool! Love that Voice.
Carol <penguincarol@hotmail.com.foofoo>
- Sunday, March 30, 2003 at 16:22:27 (PST)
5 points awarded to the HotC!! 5 points to PL House (is Ali-Pat correct Kate?) And yes, I am keeping track of points--I will post tonight after my mother and I go see "Talk to Her"!!! (She suggested it!--little does she know . . .)
CdC--After you and GG get through with Severus, he is often so tired all he wants to do is talk. So, since George (I always rather liked that name) is a bit younger and seems to have a tad more stamina, and as the HoN Wenches don't seem to mind, and as it means no disrespect or disloyalty, uh, I might just visit once in awhile.
GG--did you say Snape thongs??
Gotta go buy a t-shirt, poster book, RHPoT DVD, and new Snape doll. I'm going broke!!
Dee
Pasadena, CA USA - Sunday, March 30, 2003 at 16:21:35 (PST)
I've been missing all the fun this weekend! Out protesting in the freezing wind like the Lone Pacifist yesterday, and then DD and I started a dance class today. I may never walk again!
Dee: Media Play had the poster book when I was in there this week. BTW, wenchling, what is this about hanging around the Sheriff's place. Hmmm. We've got Gissing's Girl with split loyalties, and now you?
Nathalie: I read that interview about a week ago! How funny that we should both come
upon this old story now. I am so jealous of that kid!
Carolyn, dear Carolyn
CO USA - Sunday, March 30, 2003 at 15:52:17 (PST)
Dee, the Sheriff instructed me to, "Bring a friend," so of course you are
welcome. All are welcome.
Juliana
- Sunday, March 30, 2003 at 15:38:57 (PST)
Please oh please may those extra 20 minutes include the "Who was Dad?"
scene!!!
Ali-Pat (if I can't have TSFJG, I will settle for this!)
Dayton, OH USA - Sunday, March 30, 2003 at 15:10:41 (PST)
I found a place that mentions the RHPOT special edition release for June 10. That would be Region 1. They also have cover art if you click on 'recent postings'.
martissima
chicago, IL - Sunday, March 30, 2003 at 14:28:58 (PST)
I want to join the house of Nottingham! I think the initials should be HoN (never
really liked the name George). And the motto could be "You shine like the sun, My
Lady." Thanks for all the details about the new RH:PoT DVD. I can't wait!
Sara
UK - Sunday, March 30, 2003 at 13:43:19 (PST)
PL House finally speaks up! 5 points!
Kate
San Francisco, - Sunday, March 30, 2003 at 13:31:54 (PST)
Raining In My Heart--Buddy Holly
Tangled Up in Blue--Bob Dylan
HA!
Ali-Pat
Dayton, OH USA - Sunday, March 30, 2003 at 13:26:26 (PST)
Pop Quiz time! 5 points to the first House to answer correctly. (Dee, Ella, is
anybody keeping track of points, or have we not officially started yet?) What are the two
songs that Jamie sings to try and wake up Nina in "Truly Madly Deeply"? Title
and artist please.
Kate
San Francisco, - Sunday, March 30, 2003 at 13:01:56 (PST)
Dee I have a Snape Tshirt which I got from the same place that did the thongs mentioned on the GB around the end of December. . The web site is http://www.cafepress.com. The picture is a black and white profile of Sevy with Severus Snape written underneath, white Tshirt
Ali-Pat are you out there, just reread your last email about the web site and it didn't get here. Want to try it again?
Dee, love the questions.
Gissing's Girl <snapaholicfoo>
UK - Sunday, March 30, 2003 at 12:54:30 (PST)
I would just like to say, as sole representative of PL House, that I knew ALL the answers to the pop quizzes but have not answered because it is a hallmark of PLs (or will be once we get a few more members) to be painfully shy and moody and to sit around watching everybody else and thinking deeply about things until we finally do open our mouths and then we just come out with whatever is on the top of our heads which can be embarrassing (and we can't speel, either, so we don't like to wright).
Time to call Mother.
Ali-Pat (When did my hair go red? What a color!)
Dayton, OH USA - Sunday, March 30, 2003 at 12:54:09 (PST)
To whom it may concern-RHPOT 2dvd special (Region 2 only)is listed on Play.com
as for release 08.09.03. Being a British site I take that as 8th September and not the
backwards way the States use;)
Sue
England - Sunday, March 30, 2003 at 12:43:16 (PST)
I was going to say Wisconsin but Kate beat me to it when my attention was elsewhere.
Gissing's Girl
UK - Sunday, March 30, 2003 at 12:31:46 (PST)
Speaking of RHPOT, it's on Encore cable (US) tonight, 8 p.m. (bring a friend).
Kate
San Francisco, - Sunday, March 30, 2003 at 12:19:32 (PST)
Home again...it took me an hour to catch up on a week of guestbook! I need to be in
the Elyot house, those silk pajamas! However, there should be an occasional exchange
program so we can visit other houses of interest (all of them). And what about old
Rasputin House? (shield: wine bottles on a field of purple: motto: I am very big, {burp})
That would be an evil sort of place with plenty of "exercise".
kit
pa usa - Sunday, March 30, 2003 at 12:10:58 (PST)
Wisconsin
Kate
San Francisco, - Sunday, March 30, 2003 at 12:04:58 (PST)
Oops-Pop quiz 4: 5 points will be awarded to the House that provides the correct
answer.
Dee
- Sunday, March 30, 2003 at 11:46:35 (PST)
Hi again,
If you go to Play.com, they show that the Special Edition DVD for RHPoT will be released in August. For those interested here is the link (hopefully!)http://www.playserver2.com/play247.asp?page=title&r=R2&title=112081
Just copy and paste address, sorry I don't know how to put a link in! :0)
Leanne
USA - Sunday, March 30, 2003 at 11:46:15 (PST)
Pop quiz 4: To what U.S. State were Loki and Bartleby banished in Dogma???
Dee
- Sunday, March 30, 2003 at 11:44:13 (PST)
I was really counting on you too Kate . . .
Juliana, can I come visit the House of the Sheriff now and again? I am rather fond of him too . . . (although I think we shall have to give it the nickname HoG(eorge) as we already have an HoS--what do you think?)
I too am interested in the RHPoT DVD. I was actually going to ask Leanne about that, but sometimes, you know, there are so many posts!!
Grace, I'm going to go look for the book you mention, but we have no Woolworth's here anymore!!
Dogma on at 5:00 p.m., Comedy Central, today. I believe that's PST.
Everybody have a fabulous day!
Dee
- Sunday, March 30, 2003 at 11:42:23 (PST)
And welcome to Colonel House, Nathalie and Zoe! Sorry I blew the first question.
It's this "Sense & Sensibility" corset -- it's so tight, it cuts off the
circulation to my brain.
Kate
San Francisco, - Sunday, March 30, 2003 at 11:30:56 (PST)
VIRGINIA: Where did you find the information about the new RHPOT DVD coming out? I'm
looking on Amazon.com future releases and don't see anything.
Kate
San Francisco, - Sunday, March 30, 2003 at 11:28:22 (PST)
While looking for more information about emma thompson, I've come across a webpage of a girl who lives in Scotland and has met Alan Rickman and Emma Thompson during the shooting of The Winter Guest.Her name is Kelly Romanski. She relate her encounter with them. It was well describe, funny and ... Oh she is so lucky!!!!
This is the link to her
webpage.
Nathalie
Paris, - Sunday, March 30, 2003 at 11:26:18 (PST)
Dee: How embarrassing to get that question wrong! The hour was late, I had the
S&S script book right on the bookshelf but didn't consult it. How very bad I have
been. I shall have to throw myself on the mercy of the Colonel. And I fervently hope he's
not TOO merciful.
Kate
San Francisco, - Sunday, March 30, 2003 at 11:21:28 (PST)
Scarlet, there is a rather nice story by Adriana called Shattered that is not too
explicit. Go to fanfiction and then press the find button. Type in Adriana and go down to
Adriana(1} Otherwise try Snape in Love by Rickfan37 and Tea with the Black Dragon by White
Raven, both a little more explicit.
Gissing's Girl
UK - Sunday, March 30, 2003 at 11:13:55 (PST)
I think I shall be in the House of The Sheriff.
Juliana
- Sunday, March 30, 2003 at 10:24:05 (PST)
Hey Virginia, I am glad I am not the only one interested in this new edition DVD of RHPOT! I had posted a day or two ago asking if anyone knew anything about it, but no one replied to me.
Thanks for the info on the extra footage. I heard it was coming out in May though, but
they may have changed it to June. Sorry to hear he won't be in the commentaries, but let's
hope for some deleted scenes or outtakes with him!
Leanne
WI USA - Sunday, March 30, 2003 at 09:55:48 (PST)
Hello! Those of u who piticually like alans performance as snape, i insist you to go
buy the harry potter chamber of secrets offical poster book from wolworths!!! it has the
most gorg pic of him, it is AMAZING!!!!!! oh and where about in bath is the jane austin
musemum thing, i have to go see that picture it would be a crime if i dont!
Grace <Patchett_is_a_SPAS@hotmail.comfoo>
Bristol!, - Sunday, March 30, 2003 at 09:53:14 (PST)
Oh, and also, the new dvd will be a 2-disc set that will include cast commentaries but NOT Rickman unfortunately!
Virginia, a Rickmaniac
NYC, - Sunday, March 30, 2003 at 09:26:58 (PST)
I don't know if this has already been mentioned since I am a VERY infrequent poster,
but RHPoT: Special Edition will be out in June (I think) and is the new extended version
with about 15 minutes of previously unseen footage. I'm HOPING this will consist of
Rickman material (at least some!!), though you can bet it will probably be mostly Costner.
Does anyone have more info on this?
Virginia, a Rickmaniac
NYC, - Sunday, March 30, 2003 at 09:25:18 (PST)
Please could someone recommend me a good Snape fan-fic site. I personally don't want
anything explicit, but something that is more romantic fantasy.
Scarlet
England - Sunday, March 30, 2003 at 09:24:50 (PST)
Is it too late to join a house? If not, who to choose.... Can I be in the House of
the Colonel? He's just so dashing LOL
Zoe
UK - Sunday, March 30, 2003 at 09:00:44 (PST)
Rickfan37's 43 and 44 charters of "Snape in love" are now available. Just go and read it.
chapter 44 It is indeed quite good. Félicitation Rickfan37!!
Nathalie
Paris, - Sunday, March 30, 2003 at 06:34:39 (PST)
Rickfan37's 43&44 charters of "Snape in love" are now available. Just
go and read it.
The web page name ">chapter 44.
It is indeed quite good. Félicitation Rickfan37!!
Nathalie
Paris, - Sunday, March 30, 2003 at 06:31:24 (PST)
Troy08: I'm curious. While I admire AR, I've only seen some of his movies so far,
and none of his plays. Can you tell a little more about his role in the Anthony &
Cleopatra play, and why you thought it was a bad career move? As for me, well I think his
best career move was the Sheriff in RHPOT. The character was so over the top and his
performance so memorable (especially in comparison to the very forgettable KC), that I and
several other people walking out of the theatre wondered who the actor was that played
such a great role. I've been hooked since. Worst career move? Hmmm, not sure. I liked him
as Mesmer but hated the movie.
white raven
Houston, TX - Sunday, March 30, 2003 at 06:30:04 (PST)
Speaking of Scarlet, and way off topic, that Gary Oldham was pretty sexy in The
Scarlet letter--very bad movie though.
Dee
- Sunday, March 30, 2003 at 06:12:42 (PST)
Pam, please explain how one wins a sheriff on Ebay?? And where did you get Mesmer?? I've had a copy on back order from Amazon.com for weeks. *Sob*
Scarlet--very funny story.
Who was that who posted about the Rickman pillow?? That's does it!! I'm going to have a
Snape t-shirt made for myself.
Dee
- Sunday, March 30, 2003 at 06:11:25 (PST)
CdC, Have sent to you a third email, don't know where they are going but obviously
not to you. Pleeeeeeease say you got this one or I'm going to do penance in the dungeons
Gissing's Girl or should that be Snape's Girl. <suitablychasenedsnapeaddictfoo>
UK - Sunday, March 30, 2003 at 06:10:45 (PST)
Pop quiz 3--you AR fans did not do so well this time!! Amanda got it right first ("F Major"), but as she changed her answer, the House of Phil loses 5 points.
I am very surprised at you Kate!! 5 points from the HoTC for your inability to answer a question about the Colonel!!
Ruckus to start . . .
Dee
- Sunday, March 30, 2003 at 06:07:14 (PST)
Two weeks is a long time without you GBers!! I've so much to read!!! This interview is simply wonderful. Thank you so much for sharing. Alan a little bit racist? No, I can't believe this. No, no way indeed.
Off topic: has anyone yet come to the CDIV? I'd really like to have some report.
Which house, hein?? Duno....wonder....hard to choose...better ask the hat!! I know
"you are what your choice is" but my choices depend on my mood....
Oh well, let's go to the Colonel's House!! Even if maybe I think that FoF is a better
place to be sorted!! Let's move on, hein?? It's just the next door and surely will be more
funny!!!
Nathalie
Paris, - Sunday, March 30, 2003 at 02:28:02 (PST)
I went to Bath last week, and visited the Jane Austen Centre.They have an exclusive
photo of Alan sent in by ET from s and s. It is a black and white print of AR in costume
as Brandon holding up a piece of fabric saying 'artiste' on it. He is smiling in the
picture. I must confess to loitering around that area, and positioning myself on a seat,
where i had a clear view of him.Then i realised that i had placed myself on an authentic
antique chair, and quickly moved, lest i be spotted. On wed the 2nd of april there is a
programe on bbc2, which is examining a scene from RHPOT. Not sure which, but am hoping it
includes the sheriff. As regards Judas Kiss, not a good film, and not my cup of tea, but
Alan does look sexy in it.
scarlet
england - Sunday, March 30, 2003 at 01:27:02 (PST)
House of Phil
For the truly discerning :D
Barbara the Wallpaperer
- Sunday, March 30, 2003 at 00:03:32 (PST)
It's the key of F -- just F! Does HotC get any points for this?
Kate
San Francisco, - Saturday, March 29, 2003 at 22:23:22 (PST)
Which House, which House? Oh, dear. I am drawn to the House of Snape, for I was a
Snapefan before the movie was even cast and Snape is the intersection of two great
avocations; but I am drawn to the Colonel as well. I must ask, though: No Russia House?
And no Yorkshire's Pudding? Give me my House of Phil! Motto Just because something's fixed
don't mean you can't break it.
Amanda one last time <editor@texas.netfoo>
San Antonio, TX - Saturday, March 29, 2003 at 21:48:42 (PST)
I was just thinking it is F major!..lol..I hope I get a detention with The Master
for that!
Cathy <Iamsooashamed!@duh.comfoo>
- Saturday, March 29, 2003 at 21:46:44 (PST)
No, wait, it was simply "F," wasn't it.
Amanda again
- Saturday, March 29, 2003 at 21:43:39 (PST)
F major.
Amanda <editor@texas.netfoo>
San Antonio, TX - Saturday, March 29, 2003 at 21:42:42 (PST)
or is it E Major?...drats, I better get the DVD out again!
Cathy <OOOIhopeIgetitright@duh.comfoo>
FL USA - Saturday, March 29, 2003 at 21:33:28 (PST)
Hi, I watched the movie Mesmer the other day! What an excellent performance by AR
(all that magnetic energy-Yikes!!) I also have a snape figure with the cauldron and snake.
I also won a sheriff on Ebay!! Cant wait to get that one next week. Dark Harbor should be
arriving soon too..I guess I am one of the older "gals" on here (51) and havent
had so much fun since the Beatles were on Ed sullivan years ago if you know what I
mean..My son and I read the Harry Potter books together and love all the snape parts..
Wish there was an AR convention coming--yummy---See you all later-better get to
bed--speaking of bed-on Ebay tonight, someone is selling a new pillowcase with an image of
AR!!! Go for it girls--we will all be outbiddding each other (HA HA) Have fun- Pam
Pam <sholman@tmlp.comfoo>
Norton, MA USA - Saturday, March 29, 2003 at 21:33:02 (PST)
**Uh, uh** Is it E minor?.....
Cathy <SnapeWenchesRule!@Snape.comfoo>
FL USA - Saturday, March 29, 2003 at 21:26:27 (PST)
Pop quiz 3: In what key did Sir John and Mrs. Jennings expect Eleanor Dashwood to
sing? 5 points to the House that gets the correct answer.
Dee <IKnowWho'sGoingtoGetThisOnefoo>
Pasadena, CA US - Saturday, March 29, 2003 at 21:14:40 (PST)
Ella, I am actually 31..lol..and I'm ready to serve the Potions Master at any level,
in any order...Its great to be a SnapeWench!!
Cathy <WooHooI'mASnapeWench!@snape.comfoo>
FL USA - Saturday, March 29, 2003 at 19:54:16 (PST)
AR best move was to go back to school and study acting. I don't think Judas kiss was
a great movie yet I think facial hair is a bad career move.
Janine
Melb, Vic Austrlia - Saturday, March 29, 2003 at 19:37:44 (PST)
Since we're giving reminders, San Francisco Bay Area GBers (c'mon, I can't be the
only one!): THE WINTER GUEST will be shown on Sun. April 20, 8 p.m. on Ch. 36, KICU
(Action 36). Be warned, they chop for commercials though. (I can't believe they're showing
this on Ch 36. Maybe they thought it was The Winter QUEST.) By the way, HotC (I love that,
Ella) stands ready for any and all challenges!
Kate
San Francisco, - Saturday, March 29, 2003 at 19:03:20 (PST)
On a more serious note, I really love AR's sense of humor, in both his movies and his interviews, where he seems very down to earth, and as if he doesn't need to take himself too seriously.
Lynn, Renee, all others who do this--I very much appreciate the "heads up" regarding AR appearances. Thanks.
Ella--I am so glad you are keeping track. I'm working on some HoS Challenge questions.
S&S tonight, 8:00 p.m.--HBO. Dogma--3/30/03 9:00 a.m. and 5:00 p.m.--Comedy Central.
More Snape shopping tomorrow. I'd like a mug.
Dee <ARHasASenseOfHumorThankGrapthar'sHammerfoo>
- Saturday, March 29, 2003 at 18:54:59 (PST)
House standings are thus: HoS (House of Snape): Carolyn Dear Carolyn, Gissing's Girl, Dee, moi, C.J., and Cathy. (C.J. and Cathy, are you gals older or younger than 31? Must have a firm grasp of hierarchy so we know in what order to "serve" our beloved potions master :-)
HotC (the Colonel): Kate and Susan
HoPL: Ali-Pat
HoJ (Jamie): Aussigirl
If you want to participate in the House Challenge you must select a house! Maybe we
could give everyone a week or two to choose? (C'mon, GBers! Dust off your sense of fun and
pick a house. I promise you don't have to partake of sexual innuendo laden
discussions...if you don't want to.)
Ella <HouseCupChallengefoo>
pa usa - Saturday, March 29, 2003 at 15:54:09 (PST)
I agree with Lynda, "Les Liaisons Dangereuses" was an excellent, and
probably his best, career move since it paved the way for his role in "Die
Hard". Signing on to play Severus Snape was also a sure-fire career booster, as it
has garnered him an entirely new fan base. (Those who loathe frivolous GB posts would
probably say it was his worst career move. Heh heh. Ahem.) Colonel Brandon was also a
superb choice of roles, as it introduced him to the Hollywooed (not a typo) crowd in an
entirely different genre.
Ella <wenchdonningherseriousdiscussionhatfoo>
pa usa - Saturday, March 29, 2003 at 15:33:49 (PST)
I think MP, Eleanor, and Troy08 could use a cheering charm...what do you think, fellow wenches? I really do think that since Suzanne is webmistress, only she has the right to say what belongs on the GB and what doesn't. I appreciate the fact that not everyone here is on my wavelength, and I enjoy reading discussions of AR's work, but the fact of the matter is that AR's current projects are somewhat, well, *nil* at the moment, and that leaves very little fodder for serious discussion. I don't think any one poster has the right to censor GB material based on her preferences, I'm not at all sorry to say. If I could make a suggestion, I wonder if Suzanne would consider altering the GB format; a message board would make more sense, I think.
Well, that's all I have to say about that. I just want MP, Eleanor, and Troy08 to know
that I respect their point of view and harbor no ill will towards them.
Ella <slightlysmartingwenchmakinganattemptatdiplomacyfoo>
PA USA - Saturday, March 29, 2003 at 15:13:21 (PST)
CdC I sent the email again last night and you still didn't get it.Yet it says sent.
Will try again tomorrow, maybe third time lucky. GG
Gissing's Girl <buttonsmistressfoo>
UK - Saturday, March 29, 2003 at 15:13:12 (PST)
Dee
I'm so sorry i didn't get back to you, but i went off line to watch the greatest actor of all time.
History is one of our channels we in Canada get. I'm not sure if you get that one, Our History channel is different to the US one.
I only watch RHPOT because of Alan Rickman, he was fantastic in it.
again i'm sorry...
lynn <Pyewacket003@aol.comfoo>
ottawa, canada - Saturday, March 29, 2003 at 15:12:58 (PST)
Best career move? I'd say "Les Liaisons Dangereuses" because it started
his movie career. I didn't say Harry Potter even though it has made him more famous
because I don't think he goes after publicity. But if we're talking about money then
definitely Harry Potter! LOL Worst career move? Let's see... that's a hard one because I
like everything he's done! I guess I'll say "Judas Kiss" because it never went
to theaters. But neither did "Dark Harbor" but I like that one better!
Lynda
IL U.S. - Saturday, March 29, 2003 at 15:03:56 (PST)
ON AMC'S PROGRAM CINEMA SECRETS THEY ARE PROFILING GALAXY QUEST . THERE ARE THREE
OTHER MOVIES THEY ARE PROFILING ON THE SHOW AS WELL, AND IT'S ONLY A THIRTY MINUTE SHOW SO
THEY PROBABLY WONT HAVE ALOT ON GALAXY QUEST. I DONT KNOW IF ALAN WILL BE ON THE SHOW. THE
SHOW AIRS ON APRIL 20 . EASTERN: 6AM CENTRAL: 5AM MOUNTAIN: 4AM PACIFIC: 3AM
Renee
phoenix, az USA - Saturday, March 29, 2003 at 14:58:21 (PST)
Gissing's Girl: Still no email. Do you have the right address? It is
rbrlubber@aol.comedy (and delete the extraneous ending, edy). Please try again!
Carolyn, dear Carolyn
CO USA - Saturday, March 29, 2003 at 14:45:47 (PST)
I am going to throw in with Eleanor and MP about the recent "Wenches" silliness. Isn't their a Wenches group on Yahoo already for that kind of dialogue. God knows we all need some levity in these troubled times, but the Wenches posts were just too over the top.
On another discussion group that I belong to, we were discussing the "best and worst" career moves of certain actors. What do you all think were Alans best and worst career moves?
I think his worst career move might have been doing Antony and Cleopatra on stage(with
Helen Mirrin). And his best-doing the Harry Potter films, which has brougt him legions of
new fans. It really has helped make him more of a household name.
Troy08
Lewiston, Me - Saturday, March 29, 2003 at 14:36:40 (PST)
Dee, I agree with your comments, when there is something new or exciting to discuss I expect we will all stop this "silliness", until then there is no harm in a little fun and God nows it cheers up the world a little.
CdC, if you get any more bad you will be usurping my position as Numero Uno and then I won't be at all happy. On a more serious note , did you get my email this time? My Snape doll hasn't got a snake and cauldron he's got potions bottles instead, can't make up my mind whether to take him out of the box or not.I watched Close My Eyes last night and although I thought AR was excellent as ever I got fed up with the other 2 wrapping themselves around each other. Would have been better with AR as the brother.
As to Judas Kiss, Janine, I did not like that very much , to tell the truth I found it a trifle weird but I did watch it all the way through in case it got better.
CdC keep up the sheet polishing and Dee what is your chore?
Gissing's Girl <hoping
thesheetsaresilksosw#2fallsofffoo>
UK - Saturday, March 29, 2003 at 14:31:36 (PST)
And of course the link doesn't work. The craftspeople's unions were going to stage a
walkout that could have shut down work on "P of A" and some other movies being
made at Shepperton and Leavesdon studios throwing off release dates. But all appears to be
well now and everyone is back to work, tra la tra la...
Kate
San Francisco, - Saturday, March 29, 2003 at 12:27:14 (PST)
Work
stoppage on "Prisoner of Azkaban" averted A small newsbreak ...
Kate
San Francisco, - Saturday, March 29, 2003 at 12:24:54 (PST)
I don't wish to offend the wenches (God knows what kind of curse they could put on
me with the Professor's help!) But I agree with MP. I mean I think it's okay to be a
little silly since there's not much new to talk about. But all this wench fantasy stuff is
the kind of thing Flights of Fancy was created for (somebody correct me if I'm wrong). So
you wenches can still have your fun, but could you kindly move it next door? Just a
suggestion. It's just that I only get to read the guestbook about every other day and all
this "pretend" stuff is making it very hard to find the discussions and
information. Anybody else agree with that? Again no offense intended. Regards,
Eleanor
- Saturday, March 29, 2003 at 10:48:22 (PST)
CdC--you have been so bad that you DON'T get detention!! :0
Dee
- Saturday, March 29, 2003 at 09:36:33 (PST)
Dee: Curses! Foiled again! I am so b-a-a-a-d, truly wicked bad, that I'm probably up for detention again. Which brings me to
Gissing's Girl: Have fun on the hearth rug. I've picked my odious [HA!] chore for
detention. I'll be warming the sheets! And I mean the ones on the bed, before you evil
wenches shove me into the linen closet!
Carolyn, dear Carolyn <teacherspet@potionmasterschambersfoo>
CO uSA - Saturday, March 29, 2003 at 09:26:42 (PST)
MP, the same suggestion could be made to you, i.e., if the silliness is too much for you, perhaps you could form a more serious discussion at say, Yahoo! or Ezboard? As I note, Suzanne has never had a problem voicing her objections to posts she does not appreciate. I would also like to say that the reason all this silliness is going on is likely because AR hasn't been doing that much new stuff lately, but I imagine when Love Actually is released we shall be more able to conserve bandwidth for matters related more precisely to the work and current projects of AR. We were all thrilled to have you post the excellent interview--those, however, do not appear all that often. (And I note that it was a rather silly interview, with the interviewer even vying for a date with AR for her mother!) Indeed, some of us are even attempting to get "The Search for John Gissing" released for the benefit of all AR fans. In the interim, what are we to do??
Your comments cut a bit to the bone. Can we all please agree that not everyone in the
world likes the same things--some people are more serious, others more silly. I enjoy both
types of posts!! I would be bereft if either were gone from this excellent guestbook.
Dee <WowICan'tBelieveItWasThatForReal?foo>
- Saturday, March 29, 2003 at 08:14:44 (PST)
Pop quiz 2 winner--Aussie girl. Gawd I love it when he says that!!! 10 points to . . . what House Aussiegirl?? (I'm having trouble keeping track).
Now I shall say to Janine--as to Judas Kiss, I found parts of it a bit boring (those
without AR), but I was also highly amused by the banter between AR and Emma Thompson--I
enjoyed their dialogues. The accents were horrible, but what the heck! I suggest trying to
make it through the whole film without fast forward. (To tell you the truth, I haven't yet
been able to make it through Rasputin yet. I will rent it again, and make myself watch the
whole thing.)
Dee
- Saturday, March 29, 2003 at 08:09:35 (PST)
I started watching Judas Kiss and it is so bad, that I seem unable to watch it.
Should I try? Yet even AR voice seems all wrong. Should I persevere or just fast forward
to the AR bits?
Janine
Melb, Vic Australia - Saturday, March 29, 2003 at 05:29:38 (PST)
Perhaps those of you engaged in the game of "Snape's Wenches" might find the formation of a private group at, for example, Yahoo! or Ezboard, a more appropriate venue for carrying out your fantastical story than this particular Guestbook.
Suzanne, and this is just my humble opinion, would most likely appreciate your retreat and the conservation of her bandwidth for matters related more precisely to the work and current projects of Alan Rickman.
Just a suggestion....
MP
- Saturday, March 29, 2003 at 03:45:41 (PST)
Re Pop Quiz ---- I haven't got a DVD player so I read the book again and Snape tells
Hermione to sit down so will that do for some points for tHoOSW, extreme diligence in the
face of adversity and deprivation in that I've only got a video?
Gissing's Girl <snaping
devotedlytheruginthepm'schambersfoo>
UK - Saturday, March 29, 2003 at 02:52:06 (PST)
Seems the House thing has taken off enthusiastically. It would seem that the Snape
Wenches have had a good role model to mould themselves around. His influence is everywhere
and the things He is teaching us is not for polite company, so I'll tell you all now.
Depravity, Decadence,Wand polishing with added accoutrements, Button spells ( up and down
and in and out), Cauldron scouring-- one to one, and of course the magnificent scowl which
we are all practising face to face with the Potions Master, alone so we can give it our
utmost concentration. We are all taking our turn very nicely although the younger
contingent have to be kept in line pretty severely. I was very naughty last night so I
have volunteered myself for extra detention the next few nights brushing the rug in front
of the fire n the PM'S chambers. Interim report on the House of Snape
Gissing's Girl <lookingupwandpolishinginthemanualforforthecorrecttecniquefoo>
UK - Saturday, March 29, 2003 at 01:34:07 (PST)
FILCH:- Well take a good look, lads. This night might be the last you spend in this
castle. Oh, dear, we are in trouble. In Snape's office, he is holding up a paper for them
to see. It's a moving picture of the Ford Anglia. SNAPE:- You were seen, by no less than
seven Muggles. Do you have any idea how serious this is? You have risked the exposure of
our world! Not the mention the damage you inflicted on a Whomping Willow thats been
on these grounds since before you were born! RON:- Honestly, Professor Snape, I think it
did more damage to us. SNAPE:- Silence! I assure you, that were you in Slytherin and your
fate rested with me, the both of you would be on a train home tonight. As it is...
DUMBLEDORE:- They are not. They turn around to see Dumbledore and McGonagall standing in
the doorway. HARRY:- Professor Dumbledore. Professor McGonagall. SNAPE:- Headmaster, these
boys have flouted the decree for the restriction of underage wizardry. As such
DUMBLEDORE:- Im well aware of our bylaws, Severus, having written quite a few of
them myself. However, as head of Gryffindor house, it is for Professor McGonagall to
determine the appropriate action. RON:- Well go get our stuff, then. MCGONAGALL:-
What are you talking about, Mr. Weasley? RON:- Youre going to expel us, arent
you? MCGONAGALL:- Not today, Mr. Weasley. But I must impress on both of you the
seriousness of what you have done. I will be writing to your families tonight, and you
will both receive detention. They look at Snape, and he looks very mad. Camera flies down,
into the grounds, and into a greenhouse where students are lined up. A short, plump woman
walks into the room. HEHEHEHEHEH!!!!!! GOD I LOVE HIM!!!!!!!!
grace <Patchett_is_a_SPASfoo>
- Saturday, March 29, 2003 at 00:44:21 (PST)
HARRY Its not true, Sir, I swear. I never touched Mrs. Norris. FILCH Rubbish.
SNAPE If I might, Headmaster. Perhaps Potter and his friends were simply in the wrong
place at the wrong time. However, the circumstances are suspicious. I, for one, dont
recall seeing Potter at dinner. LOCKHART Im afraid thats my doing, Severus.
You see, Harry was helping me answer my fan mail. HERMIONE Thats why Ron and I went
looking for him, Professor. We just found him when he said
SNAPE Yes, Miss Granger?
HARRY When I said I wasnt hungry. We were heading back to the Common Room when we
found Mrs. Norris. DUMBLEDORE Innocent until proven guilty, Severus. FILCH My cat has been
Petrified. I want to see some punishment!
Grace <Pachett_is_a_SPAS@hotmail.comfoo>
- Saturday, March 29, 2003 at 00:40:29 (PST)
"Put your hand down you silly girl"
Aussiegirl
- Friday, March 28, 2003 at 23:11:56 (PST)
OK, people, I know it's late and we're all (ahem) getting ready for bed, but I think
we need a time out... Which I shall gladly provide. I've just returned from seeing the
university student's production of Faust. Not Dr. Faustus by Christopher Marlowe, but the
agonizingly long and moralistic one by Goethe. Sturm und drang indeed. But to get to my
point: The girl who played Mephistopheles (the devil) looked scarily like Tom Felton, AKA
Draco Malfoy. Oh, it brought to life all those fanfic stories... And then, when the devils
were shown in hell being all devilish and lustful, I thought about fanfiction again. I
think it's time to go to confession, ladies, I think it's time to go to confession...
Julia <when
they said "repent", I wonder what they meant...foo>
Calgary, Canada - Friday, March 28, 2003 at 23:07:32 (PST)
Pop quiz 2: What does Professor Snape say to Hermoine in the cut-out potions class
scene from Harry Potter and the Sorcerer's Stone? 10 points to the House that gets this
right.
Dee
- Friday, March 28, 2003 at 23:06:51 (PST)
Glycyrrhiza glabra is genus and species of the licorice plant. I don't like these.
Still trying . . .
Dee
- Friday, March 28, 2003 at 22:52:55 (PST)
Serpens is Latin for snake or dragon . . .
Dee
- Friday, March 28, 2003 at 22:46:46 (PST)
Aussiegirl--at the risk of incurring the wrath of the polite posters here, that was
pretty funny P=MB. Snort!
Dee
- Friday, March 28, 2003 at 22:44:35 (PST)
Aussiegirl--take the plunge!! As Kate said the big-Snake Snape does have an uncanny resemblence to AR from the side (a bit jowly there) (although the crease between the eyebrows on my Snape is a bit off-center--sits over the left eye). Other than that minor misfortune--I do love it--frock coat, buttons, flowing cape, a little wisp of hair askew, and that Snake!
Ella, no luck with the willy, but cauda means stalk of cabbage or stem!!!!--dunno, i'll keep lookin.
CdC, I think that the section you have cited refers to double fun on dungeon cleaning
duty (after all the other Snape Wenches have gone home)--I'm quite sure because Chapter 4,
Section 16 states clearly that all Snape Wenches are to be given equal time as long as
they know where their loyalties lie.
Dee <HermoineandIStudyTogetherfoo>
- Friday, March 28, 2003 at 22:41:18 (PST)
Penis is a latin word already - It's latin for "Male brain"
Aussiegirl
- Friday, March 28, 2003 at 22:21:51 (PST)
I've TOYED with getting a Snape Doll everytime I've taken the kid's to the toy shop
but have never worked up the guts to actually buy one. All this frenzied buying of Snape
dolls is moving me slowly closer to taking the plunge. I definitely want the "arm
pumpin', snake jumpin'" model if I do finally weaken. It'll look great on top of the
computer monitor next to my husband's model of Thunderbird 3! "Snape to Thunderbird
Control - all systems are GO!"
Aussiegirl
- Friday, March 28, 2003 at 22:18:37 (PST)
Cathy, I believe that each may now join the House of their choice. Welcome to the coven--you must be loyal and observe all the rules of the manual, and be, above all, a wench.
Juliana passes with flying colors--I'd give 5 points to her House, but I do not know which one she belongs to!! Where is that sorting hat?
Ella--I like the challenge idea and we must come up with an excellent Snape challenge
(will be working on it), and the Latin Willy--yes, there must be a Latin equivalent. CdC?
GG? CJ? any ideas??
Dee <LatinWillyLatinWillyLatinWillyfoo>
- Friday, March 28, 2003 at 22:18:29 (PST)
LOL = laughed (or laughing) out loud
Kate
San Francisco, - Friday, March 28, 2003 at 22:18:05 (PST)
Latin is "penis". Pardon my ignorance, but could someone please tell me
what LOL stands for? I've figured out most of the other abbreviations. Love the site. I
now know that I'm not alone as a non-repentant, unrecovering Snapeaholic
Deb
Montreal, CAN - Friday, March 28, 2003 at 22:14:54 (PST)
While I'd just LOVE to join "Snape House" I think the competiton is
already a bit stiff (whoops!) so I'm self-sorting myself into my very own "Jamie
House" (I thought "House of the Living Dead" sounded a bit B-Grade Zombie
Movieish). Colours - blue (the shade of Jamie's lips) and red (which on fast-forwarding
through the movie was really the only colour which stood out - the carpet Jamie rolled up
was red, Nina's dressing gown and blouse, the new boyfriend's car and the pregnant friends
tights). As for a house symbol I mused over the obvious cello, rats, coffin???, even
caterpillar in honour of the hideous moustache but settled on the cloud windchimes. Motto
: "I'm warming my lips" (a girl should always be prepared!). And as an added
bonus - this house has a song - "The Sun Ain't Gonna Shine Anymore". Remember
this house is going to have only a select number of members so first in best dressed (or
should that be UNdressed)!
Aussiegirl
- Friday, March 28, 2003 at 22:12:50 (PST)
Shouldn't that be WILLY, WILLY, WILLY...BUTT, BUTT, BUTT?
Just Wondering
- Friday, March 28, 2003 at 22:01:25 (PST)
I wanna be a Snape Wench!!! PLEASE??!! I already own 2 Snape dolls! AND...I just had
a knock down drag out fight for a Snape doll! LOL..just kidding! there were 3 left! So
PLEASE??? I will say the magic words..WILLY WILLY WILLY!!! and BUT,BUT,BUT...LOL...Oh and
uh..I am ALWAYS up to something...heehee..
Cathy <ireallywannabeasnapewench@ar.comfoo>
FL USA - Friday, March 28, 2003 at 21:16:58 (PST)
LOLOLOL
Susan
- Friday, March 28, 2003 at 20:44:05 (PST)
Susan: Welcome to Colonel House! Only 2 members so far, that means we each get 3.5
days a week with the musket. And the rest of him. Ella: No, I didnt alter the motto on
account of you, but because I am an insane perfectionist and I wanted all the mottos to be
the same sort. Colonel House welcomes your challenge, Snapewenches! Bring it ON Sistahs!
Somebody was asking this -- CoS Snakehandler Snape looks uncannily like AR from the right
profile. The nose is good. Also, that crease between his eyebrows. Hey, that doll is
lookin' pretty good. C'mere baby...
Kate
San Francisco, - Friday, March 28, 2003 at 20:08:34 (PST)
Ella: you've got to have a cauldron in there somewhere; he IS the Potions master. Oh YES on the "People will think you're...up to something." Can I have your dream tonight? I might rearrange the ending "just a little bit"
Dee: to "loyal, etc." add warm, lusty, sultry, scorching, torid...and GG's "depraved." And the official greeting should be a raised eyebrow and a scowl.
Hey, this is so cool--read page 66 (subsection IX): "Elementary arithmancy dictates that Snape Wench #2 gets double the pleasure, double the fun especially in months that have an "R" and this factoring in and multiplying of the wench number absolutely does not hold true for anybody else." I'm going to log in all the citations as they come up...just in case.
Renie: where is the "Which Character Are You?" Quiz?
Carolyn, dear Carolyn
CO USA - Friday, March 28, 2003 at 19:42:48 (PST)
Drat! And I've been staring at it for five minutes trying to crack the code. Has Julianna got it right?
Dee, do you know Latin or anyone who does? I was wondering what the "willy" equivalent is in Latin. (Wouldn't that look nice below the shield :-) Or maybe make something up that sounds Latinish. (I'm so terrible with languages and don't trust myself to do it.)
Idea! How about a Challenge for the House Cup? Every house (once they've been filled) could compile a list of obscure AR movie details, ala Trivial Pursuit, and whichever team gets the most answers correct, of course, wins the hypothetical cup. (They would have to be *very* obscure details so that those who review the movies will have a bugger of a time finding them.) Or, there could be a time limit on answers, such as 12 hours. It would work so long as people are given enough advance notice. (Maybe it would work better that way, yes? Then house members wouldn't know what to study beforehand!)
e.g. Snape's house schedules a challenge for the Colonel's house on soandso date. The Colonel's members get maybe a week to review their movies and then answer questions that Snape's delegate posts on the scheduled date.
How many houses are there now?
Ella <thewenchhasthrowndownthegaunlet!foo>
PA USA - Friday, March 28, 2003 at 19:15:50 (PST)
Dee, Alan Sidney Patrick Rickman" isn't that a lovely name? I think so. Do I
pass?
Juliana
- Friday, March 28, 2003 at 18:59:58 (PST)
Does the CoS Snape look anything like AR? (My SS Snape's eyes are too close together :-P) I think I need to make a trip to ToysRUs this weekend and track down this snake wielding Snape. I want to pump his, er, arm and watch his snake dance too!! (Yeah, yeah, yeah ;-)
Dee, of course! *bows obsequiously to wench no.3* I will e-mail it right out when completed. (Er, I guess I'll need e-mail addys, huh?) Mine is its_ellamentary "at" msn "dot" com. (No penis enlargers for me, thank you!) Oh, and, yes, someone should flog me (ahem, I have just the professor in mind!), or my subconscious, for ending that dream on a lame note. If it had been a *lucid* dream, there would've been a different ending, oh yes.
Kate, I hope you didn't feel obligated to alter your house motto on my account! I forgot about the "finger lickin' good" one--thought that was cute :-) Libertines are nice to lick, too, of course. (Bad, bad, Ella! I need...oh forget it...I'm getting off onto a salacious track here and should stop while I'm ahead. I hope my subconscious is taking notes ;-)
Ella <Hosethiswenchdownquickly!foo>
PA USA - Friday, March 28, 2003 at 18:34:23 (PST)
Kate, I want to be in the Colonel House too. You can polish the musket, but I want
to load it.
Susan
- Friday, March 28, 2003 at 18:24:16 (PST)
Pop quiz: What does A.S.P.R. mean???
Dee <HaveYouBeenStudying??foo>
- Friday, March 28, 2003 at 18:21:23 (PST)
Kate, well yes, the snake jumps quite a bit when I pump Snape's, er, yes, when I
pump his arm--you know--you know--that's the one!!! :)
Dee
- Friday, March 28, 2003 at 18:13:18 (PST)
Dee, does your snake jump out of the cauldron when you pump Snape's ... arm? Just
looking over the cable guide (US) and see that "Judas Kiss is on HBO in April - first
showing in the wee hours of April 3. Yee-haw!
Kate
San Francisco, - Friday, March 28, 2003 at 18:06:50 (PST)
OH!! Sorry that's LYNN, LYNN not Lynne. Sorry!!!
Dee
- Friday, March 28, 2003 at 18:05:15 (PST)
Ella: I prefer Extremely Loyal, etc. (as in I am extremely jealous that you are dreaming of AR, and dang, girl, you had him and let him go??? Dang. I mean, it was a *dream*.
Lynne what is History??? Can I see it here in the US??? Pleeeeeeze come back on line Lynne, pleeeeeze.
Ella?? Are you going to share your design, Hmmmm? I'd love to see.
Yes, a convention!!! A convention of all the AR Houses!!
I still haven't heard back from those stinker Binder brothers--don't they want to make some money?? Got a real gold mine right here.
I love my Snape figure--must be just like Kate's Snape--has a lovely big snake (heh).
Willy, willy, willy, willy, (hey, should that be in our crest somewhere???)
Dee--lighted to be a Snape Wench
- Friday, March 28, 2003 at 18:03:56 (PST)
Hello all, this is just a reminder
Alan Rickman will be on tonight at 9pm on History, for those in Ontario area, he'll be
in RHPOT. Enjoy....
lynn
ottawa, canada - Friday, March 28, 2003 at 17:25:38 (PST)
Oh, I screwed with the end of my post. (Magical vibes were disrupted by thoughts of wands and buttons...)
Rickfan888, yes! That's exactly what I meant. "Mexico isn't exactly known for its film industry, is it? (If it is, excuse my ignorance :) So it might be unusual to come across a really excellent Mexican director since they dont have a place for them. I think thats where the 'but' came from. Who knows." I, being a somewhat PC kind of gal, would frown, slightly, on the implication that it's a rarity to be exceptionally talented *and* Mexican...but, there you have it. "Like Water for Chocolate" is one of my favorite movies, by the way.
My dream, my dream! I forgot to mention the incredibly vivid (you know, when you can actually *feel* things?!) dream I had last night. AR, wearing a hideous yellow sweatshirt and jeans, and I were standing in his living room hugging when he pulled me onto the floor and began kissing me passionately (straying some distance from my lips, too!). And then I stopped him and said it wouldn't be right, because of Rima. And he looked incredibly dissapointed yet understanding.
I woke up flushed from head to toe! Oh my oh my oh my. I'm still trying to come back
down to 98.6...
Ella <Woohoo!_Look ma, I'm
a wench!!!foo>
PA USA - Friday, March 28, 2003 at 16:18:31 (PST)
In the interest of uniformity between Houses, I am changing the Colonel House motto
from "House of the Colonel -- it's finger lickin' good" to this quote: The worst
of libertines. It's still finger lickin' good though. Carry on.
Kate
San Francisco, - Friday, March 28, 2003 at 16:18:30 (PST)
Whatwhatwhat?!! Waitaminute! All the other houses have quotes as their motto. We would seriously disrupt the flow of Rickman vibes and create disharmony in the Rickman universe if we were to break with tradition. (Besides, I'm still enjoying sins of a youthful and conspicuous nature!! ;-) I was thinking of that lovely line: "People will think you're...up to something." Yesno?
C.J., spit it out, luv. How old are you? I need to know where I fall in the hierarchy. (31-going-on-17)
GG, CDC & Dee, I think C.J.'s black cape and "era" clothing more than qualify her as a wench. And especially if she's ever said "Harry Potter, our newest celebrity" while wearing said cape.
Now I need to know if the organization is the "Extremely Loyal Order of Oversexed Snape Wenches" or the "Loyal Order of Oversexed Snape Wenches" because I'd like to work up a logo this weekend for stationery purposes, etc. (Don't get too excited yet...my design program is primitive, but I think I can turn out something impressive if only it'll cooperate with me.) I'm thinking of doing one with Snape and one of a heraldic shield with wands and buttons and...what else? Throw some ideas at me, girls :-)
Carol, an AR convention?!?! What an awesome idea!! If he decides to "tread the boards" again on ol' Broadway, I say that would be the time and place to do it!
Ah, I was going to be a grown-up for a little, but I think I'll kick off the weekend in style...
WILLY WILLY WILLY WILLY WILLY WILLY WILLY WILLY WILLY WILLY!
Ella, extremely grateful to be a Snape Wench! <WoohooI'foo>
- Friday, March 28, 2003 at 16:03:23 (PST)
Hi! I've been on vacation, so I've been reading what I missed. That interview MP posted was great. It doesn't seem like the interviewer did very much research on his career...The Winter Quest? I laughed anyway. I didn't think he was racist (sorry, I know you already had this discussion, not trying to drag it up again). Mexico isn't exactly known for its film industry, is it? (If it is, excuse my ignorance :) So it might be unusual to come across a really excellent Mexican director since they dont have a place for them. I think thats where the but came from. Who knows. Maybe I'm just spouting off.
I watched Quigley down under yesterday
ahh, Ill never tire of that movie. I
was surprised, he looks so thin! Maybe its just the clothes? I dont know, but
he was adorably handsome as usual. Good day!
Rickfan888
Boise, ID USA - Friday, March 28, 2003 at 15:47:29 (PST)
So far, the House standings are thus: House of Snape, 5 self-sorted members (GG,
CDC, D, Ella, CJ). PL House: 1 self-sorted member (Ali-Pat). I am self-sorted into Colonel
House. Come on! Hans House is empty, and we can't really mount (heh-heh, she said
"mount") a real challenge against the Snapes for the House Cup with this pitiful
showing! On the upside, Ali-Pat and I do have our Heads of Houses' undivided attention.
Ah, must run. The musket needs polishing ...
Kate
San Francisco, - Friday, March 28, 2003 at 15:45:23 (PST)
GG--me too!! Me too!! I got myself a Snape action figure!!! It was the last in the store too!! (What is the deal with that??)
The House of Snape Wenches--loyal, faithful, dark and enigmatic, excellent wand
polishers (many other traits--but must run--me mum's here for a visit . . .) She thinks my
Snape is weird--what does she know?
Dee
- Friday, March 28, 2003 at 15:26:42 (PST)
I forgot to say that the motto of the House of Snape Wenches is "Sins become
more subtle as you grow older" and we Snape Wenches can sin with the best of them and
then some. After all we have to learn something in the dungeon while we are waiting for
our potions to come to the boil!
Gissing's Girl <fromthehouseofsnapewenchesno1ofcoursefoo>
UK - Friday, March 28, 2003 at 15:18:42 (PST)
Iwould like to proudly announce that I am the happy owner of a Snape mug and action figure. The postman finally brought the mug (I was going to lie in wait for him tomorrow and hex him) and I went all by myself to Toys R Us and screwed up my courage to take the last Snape figure to the cashdesk.It's now standing in my kitchen where I can ogle it at regular intervals!.
Good idea about the Houses, we 5 Snapers all got sorted for our devotion to wands,
cauldrons,wands,buttons,wands and complete depravity. Our colour is deepest black with a
small touch of white at neck and wrist(linen of course). Our Manual is available at a
price for perusal by other houses on October 31 All Hallows Eve. All enquiries to
GG,CdC,D,E or CJ. ps our flag has a rather fetching portrait of a certain Potions Master
who is scowling very knowledgably (at us of course). Welcome Ella and CJ.
Gissing's Girl <snapedtwicetodaywithmugandactionfigurefoo>
UK - Friday, March 28, 2003 at 14:18:18 (PST)
Alan Rickman didn't say he was married, he said Just a Little. And if he is, let him
be, that was his choice because he loves someone. I respect that he is married 'just a
little.' But I am still in love with him myself. Also, Miss Horton isn't his wife really,
because he says it better to stay the way they are. And adding, who needs a little piece
of paper when you have got 35 years together? But I've met him, and I say he is the
sweetest person in the world! And we only had a 10 minute conversation! I love him! And I
simply cannot wait until Love Acutually comes out!
Sabrina <xtugood2btrux@aol.comfoo>
New York, NY - Friday, March 28, 2003 at 14:11:21 (PST)
Dee, GG, Ella: somebody look up our house motto and post it. I'm, uh, busy right now
Carolyn, dear Carolyn
CO USA - Friday, March 28, 2003 at 14:06:22 (PST)
Excellent idea, Kate! We need more "houses" to absorb all these other women. I'm greedy and grasping enough to not want to cede another minute to other Snape Wenches. Take this as further proof that it is I who SHOULD BE #1 WENCH! Watch your back, Gissing's Girl; I will be whispering calumny and insidious desparaging remarks (in between moans) to MY SNAPE in the midnight hour! And what's with that screen name? We'll discuss this further when you've had time to decide WHERE YOUR LOYALTIES LIE! See you after my time is up, and not one second sooner!
!!!!!!! Extra exclamation points may be added after sufficient mulling.
Carolyn, dear Carolyn <snapewench#2andambitiousenoughtobe@#1.comfoo>
CO USA - Friday, March 28, 2003 at 13:54:56 (PST)
Kate--brilliant. I'm speechless. (I'm also self-sorted into PL House.)
Ali-Pat
Dayton, OH USA - Friday, March 28, 2003 at 12:31:14 (PST)
Corrections made.
Suz (D.o.C.)
DOC, please delete first post and remove the colon from the DT Private Lives link?
"Thanks."
R
Hmmm. Does this qualify me for dentention? , - Friday, March 28, 2003 at 12:30:23 (PST)
Kate. Lovely. I remember taking the "Which Character are you?" Quiz, so dutifully, I should like to establish--Elyot House-- Colours: Black and patterned gold on silk (after his silk pajamas and robe). A typical house member is: Jagged with sophistication. Motto: "I wish you were too." Symbol: The Duke of Westminster's yacht.
With my profuse apologies to Hans, who (already) has my fictional affections, and to
Colonel Brandon ("I'd never pass the typical house member character test, sir.")
Sorry, DOC! Renie
- Friday, March 28, 2003 at 12:20:36 (PST)
Okay, Dee... I'll confess. When I had the chance to buy the Snape figure, I was
still in the 'denial' stage and trying valantly to hide my addiction from my husband and
son. As for my son??? How can I break his trust? He thinks I'm truly, madly, deeply in
love with HARRISON FORD. My son still buys me anything that has Harrison Ford in it. He
spent years hearing me say "I'd trade your father any day for Harrison Ford" And
now I have to break his heart and trust and tell him I'm in love with YET another man???
Oh, it's so hard... I need to work on the muggle memory spell! Okay, I'll confess to my
son, which I think he realizes that IS why I watch Dogma, not to mention the fact he was
home the weekend I rented: Die Hard 1, Quigley Down Under, Galaxy Quest. He wasn't sure
why I was searching the video stores looking for Dark Harbor - I hadn't the heart to tell
him it was yet another "AR" movie. sigh. I'll tell him this weekend. Can I be a
wench now???? I have a black cape and lots of 'era' clothing. P.S. I wouldn't mind my
'pretend' Snape talking to you, but his wand belongs to me!!!!
CJ
- Friday, March 28, 2003 at 12:04:19 (PST)
And, yes, MP, thank-you for the transcript.
"AR: It cant be Sense & Sensibility because it would be Thank you."
LOL.
Renie, again
Marin, CA , - Friday, March 28, 2003 at 11:55:08 (PST)
GBers, I propose that we take a cue from Hogwarts and sort ourselves into Houses.
Seems like the House of Snape is already full up. So I move that we acknowledge the
following three new houses. 1.) Colonel House. Colors: Melancholy blue and regimental red.
Symbol: A fully loaded musket. A typical Colonel House member is: The kindest and best of
men/women. House Motto: Home of the Colonel -- it's finger lickin' good. 2.) Hans Gruber
House. Colors: Black, with maybe a nice silvery-blue Zegna tie. Look, I could discuss
men's fashions with you all day, but I must move on. Symbol: A walkie-talkie. A typical
Gruber House member is: An exceptional thief. House motto: I am going to count to three.
There will be no four. 3.) P.L. House. Colors: Greasepaint white and motor oil black.
Symbol: A hook. A typical P.L. House member is: Heroical, twice nightly. House motto:
There are things that come first -- lots of things. Now, where's that Sorting Hat?
Kate
San Francisco, - Friday, March 28, 2003 at 11:53:35 (PST)
The Snape Wenches have me exhausted just thinking about their exploits . . . (If I
get a Snape, will he do battle with the Lockhart on my iMac? If so, I'll need to find that
dueling version of Lockhart as well.) This has been an exhausting week for many people, so
I though I'd post this utterly frivolous list of romantic
movies to consider for the weekend escape. (No, I didn't write this list.) Sense &
Sensibility is listed as number 6. Having recently rewatched Roman Holiday, I'd say go for
that, too.
Renie
Looking for escape..., - Friday, March 28, 2003 at 11:49:39 (PST)
GOD! i didnt think that AR was married (in interview below) was that a typing error
or correct! plz say typing error, WIFE! are u having a joke with me or WHAT???? Im going
mad HELP!!!!!!!!!!!!!!!!!!! oh and i read some other stuff people had wrote about having
his phone number! I think this is sooooooooo sad do u really believe that this number is
correct in the first place. secondly do u have ne respect for him, ok so he is great, but
apart from being great he is an ordinary person who desearves a little respect!!! Im going
to write to the address thats written in the FAQ's!!! but i dont no what to say i mean he
think i was weird if i go on about how much i adore him! i cant believe im saying this
stuff im only 14 and im obsessed with him! is this right???? I really want to go to one of
his theatre shows in london but my parents would never let me go! god knows what i am
going to do!!! by the time im older enough to go he'd quite the stage and retired! life is
not fair! well id better go! Corrie is on (although richard has gone and im deply upset i
still watch it) and i have to go watch!!! some1 reply and help stop me from going insane!
P.S AR: Yeah, oh no, Im there. You can buy a Snape doll if youre that insane.
(im not insane, well technically i didnt buy it cos i was 22p short, but i was thinking
bout it!)
Grace <Patchett_is_a_SPAS@hotmail.comfoo>
- Friday, March 28, 2003 at 11:37:20 (PST)
I must say I never even noticed a "damn". Over here, it is in common usage on TV by politicians and children etc etc. Just goes to show yet again the huge difference in the use/misuse of the English language in different countries.
BTW whoever was asking for A Little Like Drowning can find it on Claudia's Wonderful Page
Sue
England - Friday, March 28, 2003 at 10:38:15 (PST)
CdC, GG, Ella, my vote is "yay" for CJ under one circumstance: she must
admit to her son that she watches "Dogma" ONLY because Alan Rickman is in it. (I
was considering having her husband leave regular phone messages for us as part of her
"hazing" into the coven, as I believe he's the DH who pretends to be AR on the
phone, but I ix-nayed that as perhaps being a tad too expensive and it would cut into CJ's
Snape figure budget--) Uh, you do have a Snape action figure, don't you CJ??? Hmmmm? After
all, one must wear the mark of the Snape Wench proudly!!
Dee
- Friday, March 28, 2003 at 10:24:38 (PST)
Gaye
I also "share" Harry Potter items with my daughters as well. They love everything about HP, including the Potion Master. It's always fun when my eldest brings out her Poly-Potion Kit and we start creating. They still haven't figured out that they don't have any Snape movie trading cards in there set, those are MINE!! I have to admit though that there are just somethings I won't share with them.
My DH just doesn't understand about AR or wants to try. That's OK though, everytime we
pisses me off I just buy another movie on him!!
Tina
Chicago, - Friday, March 28, 2003 at 08:13:13 (PST)
What does it take to become a Snape wench???? I 'think' I qualify.... who do I have
to beg (pleezzeee pleezzee)
CJ
- Friday, March 28, 2003 at 07:19:43 (PST)
Thanks for that highly entertaining interview transcript! It impresses me how kind AR is to youngsters. I think my favorite part was the film dialog quiz. How funny to see that lines that are as familiar to fans as the sound of their own heartbeat are wiped clean out of his head almost immediatley after he has finished recording them on film. A good thing, actually. As for his seemingly disparaging comments about non-English speakers(his driving instructor, Pedro Almadovar, Ang Lee, and the director of the most recent HP whose name I won't attempt to spell off the top of my head) I agree with Cindie's assessment. I like to believe he is merely thinking of the extra communication challenges that always arise when working with those who do not share one's language or cultural perspective.
As for Women on the Verge--see it. I think it is one of the funniest movies ever
made!
Ali-Pat
Dayton, OH USA - Friday, March 28, 2003 at 06:41:35 (PST)
Oh GG!!, you are quite right!! Seems every time Professor Snape tries to tutor me in
manual intracacies (ahem) we don't get very far, (as Snape Wenches 1 and 2 are always so
diligent about studying, they never have time to help him with necessary chores like wand
polishing and potion experimentation!!) we often must drop the manual to dash to the
dungeon and take care of more important business!!! Of course, you are SW#1--are you
insisting upon going first?? ;)
Dee <OohOohIKnowTheAnswer!CallonMe!!foo>
AlwaysDeferentialtomyElders, TheDungeon - Friday, March 28, 2003 at 06:32:07 (PST)
Hee-hee Janine!!! I'm giggling an awful lot at your Snape slip!!
Dee
Pasadena, USA - Friday, March 28, 2003 at 06:19:34 (PST)
CdC, don't be too down, just think while you are at the dentist that it is not the
dentist who is dealing with you - it is non other than Professor Snape. But be careful you
don't get carried away and get sucking his fingers. There must be something in the Manual
about this-- oh yes, page 3,000 section 269, third line down. Think on that while you are
there. Will email you after my Rickman fix tonight. Keep Snaping.
Gissing's Girl <stillsnapewenchnumerounodeffinatelyfoo>
UK - Friday, March 28, 2003 at 05:31:04 (PST)
Dee it clearly state on page 1 section26, subsection 109 that those who insist
ongoing first can only have 5 minutes of prime time or 7 minutes of other time, then
giving way to more worthy applicants. Please read your manual more carefully and do not
make it up as you go along. You are talking to an accredited expert here . Snape Wench#1
Gissing's Girl <grandorderof
snapewences#1foo>
UK - Friday, March 28, 2003 at 05:19:26 (PST)
I meant DO NOT need, unless it was.., well.., magical hmm, I think I better get off
the Snape Wenches territory.
Janine
Melb, Vic Aus - Friday, March 28, 2003 at 01:41:35 (PST)
Hi Gissings Girl. I have resent my last email if you do not reeive it just mention
it here. I do nott like putting my email address up here too often asI really do need and
enlarged penis
Janine
Melbourne, Vic Australia - Friday, March 28, 2003 at 01:38:48 (PST)
Sorry, got cut of in my prime and should be on my way to work but I meant to say to
CdC I will email you tonight after I've watched Close My Eyes(never seen it before and it
is burning a hole in the VCR. Janine, sorry I lost your email, something wrong here.
Please email me again. Isn't HE going to get worn out(sic) with all these Snape Wenches to
please. Got to go, I'm late.
Gissing's Girlvirtual <virtualsnapewenchfoo>
UK - Friday, March 28, 2003 at 01:33:20 (PST)
Dee, CdC, I think we'll let Ella be Official Snape Wench #4 as long as she sticks to
the rules. Just back from a virtual night in the dungeons with You Know Who. Buttons,
wands, cauldrons, potions, what more can a girl ask for? And then I woke up!
Gissing's Girl <snapewenchthe
firstandpractisingpolishingfoo>
UK - Friday, March 28, 2003 at 01:27:08 (PST)
Fausta: I have no problem with your request to include the interview transcript in the April Rickmanista Review newsletter.
Futhermore, I'm happy to hear everyone enjoyed reading the interview. It was my pleasure to be able to provide it to you. I'm hoping we will be able to actually see the interview in the near future. I also want to apologize for the lack of punctuation in the transcript. The transcriber was more concerned with accurately reporting the content of the interview than with grammatical concerns. As someone on this GB mentioned, it was a transcription of a conversation and not an essay. LOL Please keep that in mind as you read (and re-read) the transcript.
MP
- Friday, March 28, 2003 at 01:11:34 (PST)
AFI's 100 YEARS...100 HEROES & VILLAINS TO PIT GOOD VERSUS EVIL IN SIXTH ANNUAL CBS TELEVISION EVENT
Special To Air in 2003
The American Film Institute (AFI) has announced "AFI's 100 Years...100 Heroes & Villains" to be the annual theme for AFI's on-going celebration of 100 years of American movies.
"AFI's 100 Years...100 Heroes & Villains" will countdown America's 50 greatest heroes and 50 greatest villains in film, as chosen by experts of the motion picture community, in a three-hour television event on the CBS Television Network in June 2003.
Each year, the AFI program has garnered the highest rating for its time slot. Previous programs within this series have included: "AFI's 100 Years...100 Passions" (2002); "AFI's 100 Years...100 Thrills" (2001); "AFI's 100 Years...100 Laughs" (2000); "AFI's 100 Years...100 Stars" (1999) and "AFI's 100 Years...100 Movies" (1998).
"The AFI 100 Years... series has become an event on every movie lover's calendar, often sparking extraordinary national debate and driving millions of people to the experience of watching classic American movies," stated AFI's Director and CEO Jean Picker Firstenberg. "This is the institute's ultimate goal, to introduce and reintroduce generations of movie audiences to our rich cultural heritage."
For the sixth consecutive year, the primetime special will be executive produced and directed by Gary Smith; executive produced for AFI by former AFI Board chair Frederick S. Pierce; and produced by Dann Netter and Bob Gazzale. General Motors, Blockbuster, Pepsi and Anheuser Busch are returning as sponsors of "AFI 100 Years...100 Heroes & Villains."
About the Jury Process
Today, AFI distributed a ballot with 400 nominated screen characters to a jury of 1,500 leaders from the creative community, including film artists (directors, screenwriters, actors, editors, cinematographers) critics and historians. Additionally, the national membership of AFI will receive one collective vote.
This year, the jury will be asked to choose 50 heroes and 50 villains from an extensive list of characters such as James Bond, Indiana Jones, Hannibal Lecter and The Wicked Witch of the West.
143 HANS GRUBER in DIE HARD
(20th Century Fox, 1988)
ACTOR Alan Rickman
DIRECTOR John McTiernan
PRODUCERS Joel Silver, Lawrence Gordon
SCREENWRITERS Jeb Stuart, Steven E. de Souza
COSTUMES Marilyn Vance
MAKE-UP Scott H. Eddo
HAIR Paul Abascal
This is the only category Alan Rickman was nominated in. The website doesn't say the exact date this special will air, except to say it will air in 2003.
To see the list of all 400 nominees for Best Heroes & Villians go the American Film Institute's website at: AFI
Kimberly
Michigan - Thursday, March 27, 2003 at 23:54:17 (PST)
I know it is probably not too dificult to figure out yet even though I receive the
email every frIday am I never seem to be able to log onto the chat group with anyone else
on it. Boo Hoo I want a virtual reunion.
Janine
Melb, Vic Australia - Thursday, March 27, 2003 at 22:10:13 (PST)
wand = strip of licorice = awfully big burrito = WILLY!
Stargazer <stillinthegutterlookingupatthestars.com/foofoo>
USA - Thursday, March 27, 2003 at 21:44:03 (PST)
CdC--Snort!!
Dee <Page18ChOrderofWenchesYoungestFirstfoo>
- Thursday, March 27, 2003 at 20:35:43 (PST)
Oh--last comments: Gaye's glow-in-the-dark Snape sounds good too!!
White Raven: that story about your 3-year-old is pretty durn funny. :)
Dee
Pasadent, CA USA - Thursday, March 27, 2003 at 20:31:25 (PST)
"It is sooo important to know in what order we can take off and put on the frock coat buttons" <----said Dee
It's on page fourteen of the manual. See Illustration C.
Clearly, top to bottom (thus maintaining suspense and maximizing drool potential).
Carolyn, dear Carolyn <extracreditfordiligentstudy@allcostsfoo>
CO USA - Thursday, March 27, 2003 at 20:28:18 (PST)
"Butt, butt, butt, Dee," she stuttered, "we're not supposed to say
'willy', are we?"
Carolyn, dear Carolyn <ohnoshe'sonarollnow@potionroom'sdoor.comfoo>
Stone Sober, CO USA - Thursday, March 27, 2003 at 20:22:11 (PST)
I miss all the fun during the day--by the time I get home everyone's dwindling away.
Cathy, I may take you up on your offer, but I have a Target here too and I'm soooo looking forward to seeing all the Snape dolls the world has to offer, that I'm going to shop before I beg you to help me.
I think Kate must have the most wonderful Snape action figure in the universe.
Dee
- Thursday, March 27, 2003 at 20:18:26 (PST)
Now, listen to what happened to me today. I had to take most of the day off from work because I was having some furniture delivered between the hours of 11:00 a.m. and 3:00 p.m. Well, believe it or not, the furniture was delivered by 10:30 a.m. (Hallelujah!!! A sign from AR!!!) So, did I go to work??? Of course not--I HAD SNAPE ACTION FIGURES TO BUY!!!
Okay, so I get in the car and drive quite a ways to the only toy store I know of around
here--and mind you, I'm very excited to see the Snape action figures, and very nervous
there will be none available (what with all the mothers sneaking around and buying them up
under the pretense of getting presents for their little darlings--ha!! HA!). Now are you
getting the whole pathetic picture here?? Well, after driving miles, and sweating and not
going to work, I get to the spot where the toy store . . . USED TO BE!!! It wasn't there
anymore!!! There is a stationery store there in the building that once held all my
dreams!!! I was so disappointed, I almost went home to look up the closest toy store on
the internet--instead of going into work--but a small draft of reason lodged itself in my
deranged mind long enough to get to the office--where I ended up in a very bedraggled and
emotionally drained state. I am so wretched.
Dee <I'mTheOnlyOneWithoutASnapeActionFigurefoo>
- Thursday, March 27, 2003 at 20:14:00 (PST)
White raven- You're welcome! Can't wait for the next chapter, hurry! :) And thanks
for the address, I'll try that. Hopefully I'll have better luck. I'm getting ready to hurl
my computer out the window. Of course, then I'd lose all my AR pics and downloads, so I
guess I'll just have to resort to counting to ten. If that doesn't work, there's a bottle
of wine in the fridge and AABA in the VCR. Hmmm....
saturnine
MA - Thursday, March 27, 2003 at 20:11:23 (PST)
Zowie!!! Dang!!! Sheesh!!! I'm not even going to mention what those expletives relate to!!
CdC, GG, my vote is yay (sp?) to Ella, who has, on many occasions, proven herself quite
the magnificent sort to be a Snape Wench of the highest (or is it lowest?) order--but do
we know her age??? If you posted it here before, Ella, I have duly forgotten it, having
been the victim of many senior moments lately (uh, oh--no I am not senior bashing). It is
sooo important to know in what order we can take off and put on the frock coat buttons
(and when it is appropriate to say "but" and "willy".
Dee <SnapeWenchSnapeWenchSnapeWenchSnapeWenchfoo>
- Thursday, March 27, 2003 at 20:01:29 (PST)
****OK ladies***, I am taking orders for Snape dolls..I just sent 2 Snapes to a
fellow AR fan last week. My local Target here in FL has them.. I am NOT embarresed to buy
them! LOL..as I have 2 myself..he he..email me if anyone is interested!
Cathy <snapefan2@aol.comfoo>
FL USA - Thursday, March 27, 2003 at 19:39:54 (PST)
"Has there ever been and AR convention? Wouldn't that be fun!! " Carol
But this could never be--wait for it--we're all too UNconventional! [OUCH! Who threw
that?]
Carolyn, dear Carolyn
Punsville, USA - Thursday, March 27, 2003 at 18:38:13 (PST)
Sure, Aussiegirl! And I've no doubt he was wearing my trenchcoat, too! lol Wait till
your son gets to the pictures of the Mayans wearing Bullwinkle heads!
Carolyn, dear Carolyn
CA Rumba! - Thursday, March 27, 2003 at 18:33:30 (PST)
Has there ever been and AR convention? Wouldn't that be fun!!
Carol
Q Australia - Thursday, March 27, 2003 at 18:30:00 (PST)
CdC - Was helping my son last night with his school project on The Incas and blow me
down (or should that be "tie me up, tie me down"?) if there isn't a picture in
the book of a man dressed in a CHICKEN OUTFIT with a head similar to yours! If my scanner
was working I would have sent it to you!
Aussiegirl
- Thursday, March 27, 2003 at 17:45:43 (PST)
Just for the record: Almadovar is Spanish, not Mexican. When I read AR's remark I simply took it to mean that the man was Spanish which made it automatically difficult for AR to be able to work with him due to geographic logistics and the language barrier but that AR would like to work with Almadovar very much because he's such a good director.
I've never seen *Tie Me Up, Tie Me Down* but its one of those movies I always mean to catch. Maybe this will be the impetus to finally do it!
Cindie
Side note to white raven: Please write faster. :-D
- Thursday, March 27, 2003 at 16:51:29 (PST)
Hola, Lee!
I agree that "there are enough speech police out there in the nonvirtual world", *and* the virtual world, so why don't we all respect our differing points of view and allow each other the common courtesy of expressing them? I don't believe anyone here deemed AR a "racist". A few people, including myself, have said that the comment may have had racist undertones, but that does *not* qualify anyone as a bigot. We all get a little silly sometimes and sling phrases such as "hot blooded Italians" or "stiff upper lipped British" around innocuously, though it does pander to ethnic stereotypes. I, personally, would place his comment in the same category. Nothing to get excited over.
What I think is *really* silly is the notion that we can't have adult discussions on
the board without someone getting tetchy and defensive. If someone dares refer to AR as a
fallible human being, someone else gasps in horror and admonishes her for perceiving the
man as less than a god on his celestial pedestal. It's getting to be annoying. And far
more juvenile than saying "willy".
Ella
PA USA - Thursday, March 27, 2003 at 16:22:47 (PST)
Sheesh, I can see how wars start! A little jocular comment and the sky falls in.
Peace... Forgiveness....
Don't take life so seriously.
I'm almost too scared to say that I, too had noticed the "damn" in the
interview, and no way am I going on with that discussion!
Gaye My last post on this! I'm refusing to respond no matter what anyone says.
Adelaide, S.A. - Thursday, March 27, 2003 at 16:21:16 (PST)
Gissing's Girl: Bjorn Borgitall! I never got your email! Please, please write again. I'm a wee bit down. Went to see the evil dentist today and he says I have to have 2 fillings--I'd rather clean bedpans!
GG and Dee: I think Ella's sick and twisted enough to be an Official Snape Wench; what say you? OSW #2.
Just tried the Chat Room. It seems to be empty, but I may try back later.
Carolyn, dear Carolyn
CO Still trying to pick one. - Thursday, March 27, 2003 at 16:15:51 (PST)
Oh, please, people, don't start accusing the guy of being racist. I thought this was
a FAN site. I mean discussing willies is just silly, but this could get serious and
seriously harmful to someone we're supposed to care about. Unless you have an opportunity
to sit down with the man and ask him exactly what he meant/was implying by some comment,
don't read into it some meaning that may not have been intended at all. Please. There are
enough speech police out there in the nonvirtual world. Let there be some peace and a
little forgiveness here. Yes, I know this isn't my GB so if you think I don't have a right
to say this here, please forgive me for doing so.
Lee
- Thursday, March 27, 2003 at 15:52:31 (PST)
I hope Suzanne and Claudia - New Zealand don't mind, but I'd thought I'd advertise the GB Chat, which is scheduled for this evening. I'd love to meet some of the GBers there!
Solo Flights Alan Rickman Chat The next Alan Rickman chat is between between 8pm and 1am Eastern Time, 1am- 4am UK time, Thursday 27 March 2003, but you are welcome to use the room at any other time.
Also, I want to give a big public thank you to Su (Shizuka Dream) for the absolutely wonderful cds! What a fantastic present! I'm enjoying myself immensely, watching these AR bits over and over! LOL
Also, thanks to MP for the great interview transcript.
Kimberly
Michigan - Thursday, March 27, 2003 at 15:46:41 (PST)
I'm surprised that no one took notice of AR's "damn"--now isn't that a bit more controversial, since the interview appears on a youth oriented site? Ah well. (Not throwing rocks at The Man, since I'm sure I'd be guilty of the same in similar circumstances.) I thought the comment about "reading the books that are out" or "only the books that are out" (however it was worded) was gosh-darn cute! Goodness knows I would love to get my hands on an HP book that hasn't yet been published ;-)
Personally, I detected a hint of racism in the Mexican remark, and I remember something like it in a different interview (he was talking about driving school), but it doesn't lower my opinion of him and I'll tell you why. AR has struggled to reach a higher station in life, he seems a bit self-conscious about his upbringing, and so it's only natural that he would have a bit of a, eh, well, "superiority complex". Not that it makes him a lesser person, but one who struggles with self-esteem issues, as most of us do. He's inadvertently shown his Achille's heel in a public forum, whereas most of us do the same everyday in our homes and offices and shopping malls. We'll never have the pleasure, ahem, of having our moronic moments immortalized on tape or in writing. The same goes for Ruby Wax. I winced at her comment about the "vowel states", but *did* see the humor in it. (I used to live in the Cincinnati area and would've guffawed at her comment if I was still living there.) Point being that we're all human and I still think of AR as a paragon of grace and respectability.
By the way, the interviewer isn't the daughter of a Rickmanista Reviewer, is she? I
thought it was a bit more than a coinky dink that she said her mom adores him and then
made reference to recipes on the RR website. And Rima Horton is on the Youth
Whatever-It-Is board? Forgive me for leaping across chasms to frantically reach a
conclusion, but could it be that a contibutor to the RR is friends with Horton? Hmm.
Ella
PA USA - Thursday, March 27, 2003 at 13:40:22 (PST)
kate, email me I know where you can find a sherrif doll
robin <robinsky5@hotmail.comfoo>
- Thursday, March 27, 2003 at 13:14:58 (PST)
Mercy, the things one can read into an innocent statement. I have read that Mexico
has "no film community" but just isolated directors. Paraphrase, think it was
from the director of Tu Mama Tambien. If that is truly the case, and an actor would be in
a position to know, then Rickman may have been alluding to that with his comment, and not
implying racism. One wonders what the experience is like-maybe like camping, but not as
pleasant. One hears horror stories from the old timers, like Hepburn and Bogart filming
"The African Queen", about deprivations that are mind boggling. Although Rickman
has a lovely "instrument" it is on the far side of fifty, and he may not be
thrilled about subjecting it to the rigors of the Mexican wilderness. Thus, you get
"he's a brilliant director, but Mexican" as in "I would love to work with
him, but not if I have to use a sagebrush as a toilet and sleep in a sleeping bag on the
ground and drink from a canteen". Just another interpretation...
a concerned citizen
- Thursday, March 27, 2003 at 13:01:06 (PST)
Suzanne, Thank You for posting Sleep and Shadow! Here I am asking after that very thing, and all I had to do was scroll down a bit. Santa came early this year! But he was sporting a gorgeous black mane and bore a striking resemblance to The Man...and instead of "Ho ho ho", I could've sworn he said "You, polish my wand."
Dee, CDC & GG, Pleeeeaaaaaaase, with licorice whips on top, can I be a Snape wench,
too? I've had a Snape doll glaring at me from the top of my desk for over a year
now...surely that counts for something? I can provide the group with free licorice whips,
too. (I have a discount card at Honeyjugs, purveyors of quality S&M goods for
discerning witches and wizards. Licorice whips, wand enhancing potions, Bertie Botts every
flavor massage oil--you name it, they carry it.) Incidentally, I'm very, very good at
making tea and fetching potion ingredients...and would be extraordinarily grateful for
whatever Snape scraps are left over after superior wenches have had their way with him, oh
yes. Will submit resume upon request :-)
Ella <dreamingofthehighestechelonofwenchdomfoo>
PA USA - Thursday, March 27, 2003 at 11:58:29 (PST)
Oops, sorry, forgot to mention that we have the Lego figures too! It's so nice to
have a daughter to share these things with - she has the Snape figure on her bed-side
table, and I think he glows in the dark ;o) Should I admit to having Lucius guarding my
computer with his wand held high?
Gaye
Adelaide, South Australia - Thursday, March 27, 2003 at 11:56:11 (PST)
Just quickly, I feel I should defend myself here! I love AR, and the fact that he may be a "little bit" racist, only shows he's human...
Does anyone remember the interview he gave describing his driving lessons in LA? I think a smidgeon of racism exposed itself there, too.
Hey, it's no big deal. Yes, I know the word "but" could have/should have been
"and", but it WAS but. LOL Don't forget, Alan was raised in a poor area, in a
time when thoughts like this would have been quite common. I'm sure he's a very
politically correct person now, but sometimes things slip out.
Gaye, who can't believe anyone could be so upset about this.
Adelaide, South Australia - Thursday, March 27, 2003 at 11:51:36 (PST)
I got myself all worked up with my last post about the Sheriff action figure that
got away. Just back from the toy store and now have on my desk scowling at me -- the
latest Snape doll from CoS. He's holding his wand in one hand and a cauldron in the other
with a snake in it. When you press his arm, the snake pops out of his pants -- er -- pot.
So there you have it, snake in one hand, wand in the other. This must be the Freudian
Snape action figure. Wonder if this is the one AR has at home. And who plays with it more?
Kate
San Francisco, - Thursday, March 27, 2003 at 11:39:24 (PST)
Does anyone know how I might find a copy of AR's radio performance of 'A Little Like
Drowning?'
Carol <penguincarol@hotmail.com.foofoo>
USA - Thursday, March 27, 2003 at 11:03:22 (PST)
I have to tell you ladies that I really, really enjoy this guestbook!!!!! You really
take the cake! I had thought I was the only one that had this fantasies/daydreams/etc. :-)
My poor suffering husband and my son - who exclaimed to me last night "I never would
have beleived that you'd actually LIKE 'Dogma'!!!" It would have been to embarrassing
to tell my grown son that I only 'watch'it for Alan Rickman :-) I'm so glad I'm not the
only one at my age :-) Keep up the lively chatter and 'expectations' - it really makes my
day!
CJ
- Thursday, March 27, 2003 at 10:37:06 (PST)
CdC, I sent you a long email last night , don't tell me you didn't get it. Took me
nearly an hour to write. Janine, Iseem to have lost your email too, was there last night
but not today. Email me again if you want GG
Gissing's Girl <numerounosnapewenchfoo>
- Thursday, March 27, 2003 at 10:25:43 (PST)
Dee andCdC,now that I have been promoted to Numero Uno Snape Wench I can afford to
be very generous. CdC you 10.30, Dee you 10.45 and no friends or he will be too worn out
therefore making him very irascible during which time he will no doubt cancel the scraps
and Christmas.Dee not too much of the wand polishing in the 15 mins alloted to you and be
careful you don't end up scrubbing the cauldrons in the dungeons under his close scrutiny.
This would not be good for CdC and I as we don't want him to be too kna---er worn out.Just
bought a mediterranean potion from Boots the Chemist today - body butter - can you think
of anyone worthy to try it out on?
Gissing's Girl <extremelyloyalorderofoversexedsnapewenchesfoo>
UK - Thursday, March 27, 2003 at 09:53:53 (PST)
Thought I'd share this with you. Last night I popped in the HP Sorcerer's Stone DVD for my 3 -year old daughter to watch. We've both seen it about 500 times to date. Anyhoo, in the scene where Snape approaches Harry at breakfast and sarcastically wishes him good luck at the Quidditch game, my daughter turns to me and says "Mommy, I love Snape! You love Snape too, right?" I nearly blew a gasket trying not laugh out loud, especially when I heard this long, drawn out groan coming from the study and a pseudo-exasperated voice sayng "Great. Two Snape fembots in my house. What is it with this guy?"
Janine: Thanks for a reminder on the boots. Those may prove to be more of a challenge to acquire than the frock coat.
Dee: I'll be checking out the site you referred today. Even if I can't get a clear shot, I will certainly enjoy looking at AR in his snazzy outfit.
Saturnine: Thank you so much for the wonderful review you sent and the kind comments you made on this site concerning my fic. I will be sending out an e-mail to my reviewers soon. I usually do so before uploading the next chapter. I don't know which e-mail you tried to use, but give it a go at whiteraven@ev1.net.
Aussiegirl: I intend to offer a challenge to CdC to carve a life-size statue of our beloved Snape in his frock coat, buttons and all. Then I think she should have it bronzed when completed.
Carolyn, dear Carolyn: Your comment concerning the Witches of Eastwick had me LOL! Just
imagine if AR had taken that role instead of Jack Nicholson? Oooh, damnations never
sounded so tempting.
white raven
Houston, TX - Thursday, March 27, 2003 at 08:57:39 (PST)
For all those whose families have shamed them out of buying Snape dolls, I'd like to
share a sad story. The year is 1991 or maybe 1992. I'm at the mall and in the toy store
window, I see a display of action figures from RHPOT. My sister was in love with Christian
Slater at the time (don't ask)and I thought it would be really cute to buy her the Will
Scarlet figure. As I;m in there I see the Sheriff figure, and something clicks in my
brain, which has recently been destroyed by new motherhood. Alan Rickman is in "Robin
Hood"! I totally forgot! I fondle the 6 inch tall Sheriff (it has a scar on its cheek
and everything). I stand there contemplating it for many minutes. Do I buy it? NO! And I
have been searching for a Sheriff ever since. At a toy collectors' show a couple of weeks
ago, I thought I found one, but, no, it was only the Kevin Costner Inaction Figure. (Which
I'm sure is actual size, by the way, nudge nudge wink wink.) The moral of the story is:
BUY THE SNAPE DOLL!
Kate
San Francisco, - Thursday, March 27, 2003 at 08:29:31 (PST)
CdC-oh, I forgot, no comprende "yippeeyiyo" :0
Dee
- Thursday, March 27, 2003 at 07:50:03 (PST)
2 hours and 10 minutes before the toy store opens!!!!!
CdC--nosotros eres brujas (with great apologies to the Spanish language).
Claudia, phew--my Dark Mark is fading a bit . . . :)
Dee <SiSenorSnapefoo>
- Thursday, March 27, 2003 at 07:48:21 (PST)
Sorry Dee. I should have put a paragraph break before I started commenting on GML's
post. I certainly didn't mean to direct that particular part of the post at you. But (as I
scrolled further down..LOL) you did say that you "noticed that little racist thingy
too". PS--the Georgia contingency has better things to do than gang up on their
friends! LOL
Claudia
GA US - Thursday, March 27, 2003 at 07:25:31 (PST)
Okay, Gissing's Girl got promoted to Snape Wench numero uno. That makes me (agewise,
in the Loyal Order of Oversexed Snape Wenches) numero dos. Dee es numero last de las tres!
Why do I keep envisioning The Witches of Eastwick ?
Gissing's Girl: did you get my email? AOL (or A 'OLE as I'm starting to call it) is really
messing with my communications these days.
Carolyn, dear Carolyn <YippeeyiyoCalle@micasa.¿comprende?foo>
CO USA - Thursday, March 27, 2003 at 07:23:33 (PST)
Janine, I have the same dilemma as you--I love my local bookshop over the big chains even to the extent I will pay more there, just to keep it alive. As such, since the new HP movie will be released on DVD in early April, I will wait to buy the Phoenix. That way I can stretch out my doses of AR.
Cool--the toy store will open in less than 3 hours!!!
Dee
- Thursday, March 27, 2003 at 07:19:04 (PST)
Gaye--I could use a little help here--the Georgia contingent is ganging up on me!!! Claudia--will you please scroll down and note that I said exactly the same thing GML said about use of the word "but" and being under pressure during an interview (before she said it?) Dang! I feel like I have the Dark Mark or something now!!! *sob*
All I want in this world are some Snape action figures and the opportunity to be as pathetic as my fellow GBers--although I must admit that Carol and her lego Snape is really pushing the envelope of pathetic-ness (uh, is Snape made out of lego--is it cute???).
GG--I am the youngest Snape Wench? I haven't been the youngest anything in years! Don't worry luv, after I polish Snape's wand, the cauldron will be quite safe from exploding . . .
The Cupboard in Which I Keep My Ponchos-Land? Snort!
Dee <PatheticNewbyGBerWiththeDarkMarkfoo>
- Thursday, March 27, 2003 at 07:12:43 (PST)
Another place that you can look for the new Harry Potter & The Order of the
Phoenix book is at www.overstock.com. They have it listed for $15.99 + 1.40 (shipping to
US). The website says that they do ship worldwide, so you would have to contact them for
the rates. They do also accept Paypal for payment.
Tina
Chicago, - Thursday, March 27, 2003 at 06:09:13 (PST)
Has anyone heard any news on the new release DVD of RHPOT? I have seen on the internet that the run time is quite long, so I am hoping there will be outtakes or deleted scenes. Doe anyone have any more info on this?
I love all the conversations going on! Wish I had something clever to say. I read the Guestbook every day though. I have to add that I have TWO Snape figurines, one stands on top of my work computer, the other is still in the packaging, so sign me up for the club!
Okay, back to my lurking.....Take care!
Leanne
WI USA - Thursday, March 27, 2003 at 06:06:44 (PST)
Talk about being a little pathetic about having a snape figurine, well I must be the
sadest case of the lot. I have even collected the ones out of the lego sets!
Carol
Australia - Thursday, March 27, 2003 at 04:14:48 (PST)
Dee--Sabine, myself, and many others have been with this GB for a very long time so we learned to not take most so seriously a long time ago. But the "racist" remark was a bit over the top. I believe GML is right on the mark with the use of the "but" word. If anyone has ever watched any of The Man's interviews, you would know that the use of the word is within in his vocab pattern (for lack of better term) and totally harmless. Geez....AR racist? Give me a break!
I have been watching Almodovar pick up his many awards (and I was wrong...he did
pick up a BAFTA as well) the past few months and kept thinking to myself that I needed to
look this guy up. So now with The Man's blessing, I think I will begin my Almodovar
journey. The Man has never led me wrong before....he introduced me to Minghella (my
absolutely favorite) and Cuaran.
Claudia
GA US - Thursday, March 27, 2003 at 04:14:10 (PST)
Fortunately having a young boy who would like to think he was Harry Potter mean
anything to do with HP even AR and Snape stuff is cool in this house. We even read the
books together, twice and are contemplating a third read or should we keep that for after
the next books release to cover the HP drought. That being the wait for the one after the
next. Then the delema I like to support local trader yet the local bookshop will only have
it on June 21st Sat 9.30 am when it opens. The larger chain book shops have not commited
to any plans of the books release when I last asked. So who in this guestbook area would
have it available first? If it is us in OZ I promise to read it as quickly as I can
Janine
Melb, Vic Australia - Thursday, March 27, 2003 at 03:09:06 (PST)
What about the Arthouse Classic "The cupboard in which I keep my
Ponchos-Land"?
Ole
- Thursday, March 27, 2003 at 03:04:32 (PST)
DH says I am old enough to know better and it is really pathetic so I am glad there
are 2 other Snape Wenches to be pathetic with.Wish I'd bought a Snape figure when I had
the chance last Year when I was in Florida, only there was howls of despairing laughter
from my family who then refused to go to the checkout with me and said figure. Oh well
there is always this year, hope they've still got them
Gissing's Girl <againfoo>
- Thursday, March 27, 2003 at 02:33:58 (PST)
Cdc and Dee, I think I win this contest hands(? his) down. I'm the same age as AR so
I think that gives me some sort of advantage, but my birthday is in July not February. Us
Snape Wenches must stick together, I'm sure we can work it out between us, as long as I go
first. I have this burning need to be growled at while I'm learning to make potions from
the Master in the dungeons. Some of them might be a tad dangerous but knowing my luck I'll
probably blow his cauldron to smithereens!
Gissing's Girl <sins become more
subtle as you grow olderfoo>
UK - Thursday, March 27, 2003 at 02:28:49 (PST)
It's an AWFUL long time since this GB made me laugh out loud but An Awfully Big Burrito just hit the spot!!Thanks!*drying eyes*
With respect to the age question, I did a survey about this time 2 years ago when
everbody who posted over a weekend gave their ages. I seem to recall that the average
worked out at about 40/41 but I suspect that since the dreaded Snape it may have dropped a
year or two. BTW I ain't doing it again, someone else can!
Sue
England - Thursday, March 27, 2003 at 01:20:59 (PST)
Let's not forget the X-Rated SCORCHER "The Jalapeno Man". Talk about
"An Awfully Big Burrito" in that one!
Some Like it HOT!
- Thursday, March 27, 2003 at 00:18:19 (PST)
Thanks for excellent interview transcript, MP. He saw Hable con Ella ('Talk to Her')? Excellent. My favourite film of the past year. Seen it three times (with French subtitles!) but it has been in English cinemas for a while... it's a very daring film too. Has it been shown in US cinemas? There was a quote from Pedro Almodovar (the director) at the Peace concert in London last Sunday. If I remember well, it went something like "We don't understand the concept of a preventative war here... the only word we have for preventative war is 'peace'". Oh, and surely the 'but' was one of these hundred little words you use to give yourself time to collect your thoughts in a conversation, y'know: soooo, yeah, er... but-er..., yeah, mmmh.., anyway...., ah..., etc. This is the transcript of a conversation, not a written essay! Hey, he's worked with more foreign directors than most actors and has just expressed the wish to work with another one! What better compliment can you give somebody's talent? (not to mention that working with anybody else than a classic Hollywood guy probably means a paycut ;) Oh, I'd give anything to see him work with Almodovar...
GML
UK - Wednesday, March 26, 2003 at 23:57:15 (PST)
My word, you take a brief hiatus from the GB and miss a year's worth of posts (or so it would seem!). I'd like to proffer a heartfelt "Thank You" to our south of the border friends for making my day...week...month :-) Haven't laughed so hard in a while.
I'm sick, in a seriously cranky mood, my VCR decided to roll over and play dead the instant Quigley came into contact with it (I'm picking it up tomorrow and fairly certain it will sit up and beg when it realizes what a treat it's in for ;-). Anyway, I have a question. I was wondering if anyone has seen "Spirit of Man" and if it's worth tracking down. I imagine that AR has a bit role in it, since I hadn't heard of it previously.
Ali-Pat, I have something for you that will be going out in the mail tomorrow. Just to
give you a heads up. (Mucho Gracias, Senora for your generosity.)
Ella
PA USA - Wednesday, March 26, 2003 at 23:22:36 (PST)
Many thanks Frida Kahlo and Movie Buff - how could I forget those classics. With
your permission I will be adding your names to the petition I am submitting to the judging
panel of next year's "Golden Taco" Awards, nominating Mr Rickman for an honorary
"Order of the Burro" for his outstanding contribution to the Mexican Film
Industry.
A Proud Mexican
Ciudad de Mexico, Mexico - Wednesday, March 26, 2003 at 22:42:50 (PST)
P.S. I love An Awfully Big Burrito.
Love to eat
USA - Wednesday, March 26, 2003 at 22:41:35 (PST)
Are you all mad--you have neglected to mention that ever enduring political
blockbuster Roberto Roberto!! And can we ever forget the sexy and sinister Dark Rio
Grande??? Shall we not always weep to Bueno, Loco, Bueno???
Senorita Si Si el Snapo!
- Wednesday, March 26, 2003 at 22:40:41 (PST)
And what about the unforgettable "Help, I'm a Fajita"?
Frida Kahlo <salmahayekwasrobbed.comfoo>
- Wednesday, March 26, 2003 at 22:12:25 (PST)
Senor (Senora? Senorita?), you left out the fabulous Jose Pancho and the Gringo's
Dinero, my personal favorite.
Movie Buff
- Wednesday, March 26, 2003 at 21:11:19 (PST)
Dee: I agree, the word "and" would have been a better connector. As I said, I don't think AR meant any harm by what he said. It probably just came out the wrong way.
And I won't take you guys seriously anymore. I promise! LOL
Sabine
GA USA - Wednesday, March 26, 2003 at 20:42:23 (PST)
Please inform your Mr. Rickman that the Mexican Film Industry and its Directors
would like to take him to task for recent comments. He need look no further than our own
International Film Festival which was held only last week for examples of world class film
production and directing. The standard of the films showcased could, I'm sure, stand
alongside anything produced in the U.K. or U.S.A. Films such as "Sancho, Prince of
Thieves", "An Awfully Big Burrito", "Guacamole Quest",
"Gaucho Down Under" and the classic "Tijuana Kiss" prove to the world
that the Mexican Film Industry is a force to be reckoned with!
A Proud Mexican
Ciudad de Mexico, Mexico - Wednesday, March 26, 2003 at 20:20:48 (PST)
Kate--it was quite hilarious. Would that it were so easy to get a date with him.
Dee
- Wednesday, March 26, 2003 at 20:16:58 (PST)
Sabine, do not take us so seriously!! We love AR. I think the problem was the word
"but." ("Hes a Mexican but he is a brilliant director.) (Say,
Sabine's from Georgia, but she is a brilliant director--just doesn't sound quite right.)
Maybe "and" would have been a better connector. *But* heck, it's an interview
and I suppose it's difficult to be on the spot like that. We Love AR (and Georgia too). :)
Dee
- Wednesday, March 26, 2003 at 20:15:23 (PST)
I;m still laughing over AR's 4 for 7 performance on the Movie Quote quiz. I don;t
know why I find this so funny. OK, Alan, for a date with Kate, in what movie did you say
the following line: "Mr. Potter -- our newest celebrity" AR: Ah ...
"Dogma"? Congratulations! We're grading you on a curve and you WIN!
kate
san francisco, - Wednesday, March 26, 2003 at 20:07:37 (PST)
AR racist? Aren't you guys a little bit too sensitive here? I really don't think he
meant it the way it sounded; I just cannot imagine him being a racist. Not event a little
bit. And he did say that he thinks Cuaron is a brilliant director.
Sabine
GA USA - Wednesday, March 26, 2003 at 20:02:19 (PST)
Aussiegirl: The chicken mask came from Archie McFee's in Seattle. It's sort of like PeeWee's Playhouse's decorator shop! As a matter of fact, they proudly displayed an autographed photo of PeeWee on the wall when I was there. They have a website, btw. Great place to shop for things that nobody really needs. I think "marital aids" sort of fall into that category, but no, that's not what I bought it for. I've had it for years and gotten lots of [weird] mileage out of it. For instance, when my neighbor's dh was up on a ladder hanging drapes, I snuck up to the window and clucked loudly at him, almost causing him to do a triple backwards somersault to the floor. Also, I met my best friend, Renée the astrologer, through mail art exchanges that have gone on for over 10 years. At one point, she asked me for a picture and I sent her one with--you guessed it--the old chicken mask. We finally got to meet in person when I had a layover in Chicago on my way to crossing the Atlantic. AND SHE RECOGNIZED ME! She walked right up to me and said, "I'm Renée, and I bet you're Carolyn!" I'm still wondering what tipped her off.
And Gaye: I'm only doing the age competition with the other two OFFICIAL Snape Wenches, Dee and Gissing's Girl. I'm so old that I couldn't take the stress of more than three competitors. lol Be kind to me; I'm a fragile flower!
OFFICIAL Snape Wenches #2 & #3: When shall we three meet again
In thunder, lightning, or in rain?
When the hurlyburly's done,
When the battles's lost and won?
...or maybe some time when AOL's not screwing up...over and over and....
Carolyn, dear Carolyn
CO - Wednesday, March 26, 2003 at 19:36:20 (PST)
I'm not through yet.
White Raven, this site has a zillion snape pictures on it. I'm not sure you will find a good frock coat pic, but I suppose it's worth a try http://yacht.zamok.net/DV/Potter/Posters/Snape/
Oh yes, and Gaye--I noticed that little racist thingy too--but didn't want to mention it because we do love him.
Ach! You are all cooking seduction dinners for your husbands tonight, I am sure.
Dee
- Wednesday, March 26, 2003 at 19:31:37 (PST)
Wow, thanks to MP for posting the wonderful interview. I just thought Alan Rickman
mentioned the nationalities of the directors because the young interviewer might not have
been familiar with them. Cuaron directed him in Murder Obliquely, didn't he? Oh, and
congratulations to the great Fausta for her site being mentioned! How did it feel having
Alan Rickman's eyes peering at your website?? Finally, to Shizuka Dream, I'm glad the tape
was okay. Your CD is great!
sonoma
usa - Wednesday, March 26, 2003 at 19:27:19 (PST)
Holy moly, what a rash of posts!! Don't you people ever work??? (Heh). I wanna Snape mug and a Snape action figure and TiVo and my Mesmer video and, and I want Snape in the flesh!!! (I'm not asking too much am I?)
CdC I think your chicken head speaks volumes about your true age, so don't even think you are going to be first in line for the frock coat. GG--spill the beans about your age--we are all as silent as the grave here . . .
Gaye, I think from the posts we can tell who the youngest AR fan is--and I think there is one from someone in her 70s. Does anyone remember that?
Aussiegirl, I loved Colin Firth in Pride & Prejudice--Oh Lordy!! Never really liked anything after that ('cept maybe Bridget Jones . . .) Uh, and I think you hit the nail on the, um, chicken head about CdC's *secret* passion for, well, chicken heads
Ha-ha! who said the thing about her daughter thinking the Snape mug was for her--that
was funny. :)
Dee <IDontHaveAnySelfRespectEitherfoo>
US - Wednesday, March 26, 2003 at 19:27:14 (PST)
Just thought everyone would like to know, that Coles is now reserving the new Harry Potter book. and you get 20% discount if you preorder it, I did , yesterday.
and on television this week, Friday, on History Robin Hood:POF will be showing, so
check your local listings.
lynn
Ottawa, canada - Wednesday, March 26, 2003 at 19:24:08 (PST)
Oh, it's funny that the interviewr called TWG the Wonter Quest... When I was
ordering TWG soundtrack, the girl at HMV made the same mistake. But I only realised after
I left. So I lived in fear for the next two months, or however long it took them to order
it in for me, that I'd get this wierd soundtrack for some wierd movie called the Winter
Quest, which would probably have a very cold-looking Harrison Ford in it, or something!
Fortunately, intelligence (or divine intervention) pervailed, and I got the genuine
article...
Julia
Calgary, Canada - Wednesday, March 26, 2003 at 19:19:51 (PST)
Yes, I loved that transcript, too! Thanks so much for posting it. Did anyone notice that Alan's a "little bit" racist? Not to worry, I still love him! We're also insane in this household, as we have two Snape dolls. (Not to mention the Lockhart, Quirrell and Harry dolls.)
Thank you also to the person who posted about the Comic Relief Appeal (French and Saunders) pictures being in our curent New Idea Magazine. They're great!
Re the Snape mug: I was lucky enough to buy three of these at Christmas time, one for me, one for my daughter, and one for a fellow Rickmaniac. They were about $A10, but I haven't seen any since then. If any other Aussies are looking for them, I bought mine from David Jones and Myers.
Finally, have we established just who is the oldest poster here? Are we willing to
admit our ages to win the prize? LOL
Gaye, who's feeling quite old just now
Adelaide, South Australia - Wednesday, March 26, 2003 at 18:24:10 (PST)
Fausta, I think should only accept recipes for your site with the following criteria -
1. No cooking required - can be prepared in front of computer/VCR/DVD player
2. Only one container *disposable* can be used in total preparation and consuming
3. Can be slurped from said container without need of cutlery etc
That way Rickmaniacs need not waste precious time preparing/eating/cleaning up. Then
all we'll need is a self-cleaning bathroom!
Aussiegirl
- Wednesday, March 26, 2003 at 18:10:10 (PST)
white raven-I was hoping you were on the GB again. I tried to email you back after I
read your last chapter but it bounced. And I'm having problems getting on to fanfic as
well. So, I'll just say here that your latest chapter was wonderful, and anyone who hasn't
taken a peek at "Tea with the Black Dragon" should really do so. It's one of the
best fanfics I've had the pleasure of reading and her Snape is sooo dark and delicious!
Yum! :)
saturnine
MA - Wednesday, March 26, 2003 at 17:40:55 (PST)
Dee- You are more than welcome, no dishwashing required, we'll do take-out! I'll
have the TiVo waiting-the husband's resolve is slipping, I can feel it. However, if we
still have snow in June, you're going to have to take me back with you! MP-Great
interview, thanks for the post. It was a nice surprise after a too long day of classes.
saturnine
MA - Wednesday, March 26, 2003 at 17:28:56 (PST)
White Raven, I'm sure CdC has "a very clear picture" of Snape's frock coat etched in her mind - right down to the last button! Maybe she could describe it to you and you could sketch it for your seamstress. Or maybe your seamstress is a closet Rickmaniac and has a very good idea of it herself - you just never know! Appearances can be deceptive, as we all know! Just two days ago when I told someone my favourite radio station they said they were amazed and that I "didn't look the type". Didn't know whether to me insulted or flattered!
For Aussie information - April's Australian Women's Weekly has 4 yummy pages devoted to Colin Firth. I mention this because there seems to be an overlap between those who admire AR and CF. Entirely unlike AR and poor ole Kevy Costner who's fan bases seem to be "mutually exclusive" (but for fear of being totally banished from the GB I must say I liked him in "Tin Cup" where he plays a bit of an "Aussie Larrikin" type character). Anyway, in the CF article there is no mention of "Love Actually" which I was hoping there would be so that this isn't totally off-topic!
Thanks also to MP for the transcript - I enjoyed it!
CdC, did the "chicken head" puzzle, but the bit that puzzled me was why you
own a chicken head! Do you get much use out of it? Do you keep chickens and it induces
them to lay more? Is it some type of *gasp* sex-aid? Where on earth did you buy it or did
you paper-mache it youself?
Aussiegirl
- Wednesday, March 26, 2003 at 17:18:11 (PST)
Dee said, "GG, I think you'd have to let your elders go first :)" Then, I
believe GG said something to the same effect. Very well, ladies. It's about time I got
some respect around here! Actually, I don't think GG has spit out her age qualifications,
but I am willing to carry away the prize by default! Now, please go away and leave the
Professor and me to our cross cultural bonding [wizard/muggle, Brit/American,
introvert/extrovert, and let's not forget MALE/FEMALE! BTW, I would be willing to share
the kitchen (and other rooms) with Mr. Rickman. Tonight, it's ajiaco, so Snape Wenches #2
& #3 can do the dishes!
Carolyn, dear Carolyn
CO USA - Wednesday, March 26, 2003 at 15:26:39 (PST)
Hey. I am a huge fan of Alan, and I know that he does not read this but I tottally
love him. He is so calm,cool, and collected. His voice just makes me melt. His eyes are
like fire burning deep within my soul and his hands are so slender and smooth I would like
to see just what he can do with them. HEE HEE. Well, I guess I should confess I am a 14
year old girl who has no control over her hopeless obsession for Alan Rickman. He's just
so neat and I would really like to get to know him but I know there is no hope of ever
meeting him. Unless I follow him around or accidently run in to him on the street, and
even then i would be so speechless I'd just go and make a idiot of myself. Well I have to
go now... Goodbye
Sahsa Snape <www.amberr_88@hotmail.comfoo>
London, ---------- England - Wednesday, March 26, 2003 at 14:30:34 (PST)
White Raven don't forget the boots they were snazzy.
Janine
Melb, Vic Australia - Wednesday, March 26, 2003 at 14:15:13 (PST)
Oh Renie now I know who the director is. The funny thing is I always used to get
mixed up with who directed TMD and TMUTMD I must have been confused by the string of t m
and d. MP thank you for your work. Reading between the lines I was amused that he did not
say he never uses the internet, so hmm I am glad he had a squint at Fausta's page
Janine
Melb, Vic Australia - Wednesday, March 26, 2003 at 14:09:05 (PST)
Does anyone have a VERY clear picture of Snape's frock coat? The entire outfit, sans
the robe, would be even better. My husband and I will be attending a Victorian ball at
Dickens on the Strand in Galveston this year and want to have costumes made for the event.
I have finally convinced him that he would look awesome in such an outfit. It took him
forever to get past "My God, would you look at this guy's snoz?" to actually
take a look at the outfit in different pictures. However, all the ones I've seen just
aren't clear enough. I just need a really good pic. to show my seamstress. Many thanks.
white raven
Houston, TX - Wednesday, March 26, 2003 at 13:05:15 (PST)
White Raven: I'm ashamed to say that I got the Snape mug off Ebay .co.uk for £7.50
plus postage which would be about $15. It was in an auction of AR memorabilia and I waited
until the last 5 minutes before slamming in a bid. Just shows to what depths one will sink
to get what one wants(Dee and CdC watch out).Go onto Ebay.co uk and type in Alan Rickman.
It hasn't arrived yet so the postman is going to be in trouble tomorrow if he doesn't
bring it! I got a video of Close My Eyes the same way. Desperate people do desperate
things.
Gissing's Girl
UK - Wednesday, March 26, 2003 at 13:03:28 (PST)
Many thanks MP for the transcript! Is this adorable or what -- He has his own Snape
action figure at home! Now if I had to bet money on whether or not AR kept his action
figures, I would have said no. Wonder if he has his Sheriff action figure from Robin Hood
too? And the pop quiz on the movie quotes was priceless! WE know his work better than he
does!
Kate
San Francisco, - Wednesday, March 26, 2003 at 12:54:42 (PST)
Hmmm, "Women on the Verge of a Nervous Breakdown"....sounds like Almodovar has been peeking in my windows! LOL
Thanks for the heads up Renie. I'll have to look them up.
Claudia
GA GA - Wednesday, March 26, 2003 at 12:44:03 (PST)
Another vote for "Talk to Her"--also try "Women on the Verge of A Nervous Breakdown" and "Tie Me Up, Tie Me Down"", in that order. He's quite a character, in print interviews as well.
Fausta, *test* them? It sounds like something The Interrogator might do with a recipe!
LOL. Anyone who doesn't know about the Rickmanista is missing out, BTW.
Renie
- Wednesday, March 26, 2003 at 12:34:03 (PST)
Wonderful news, Cindie. Thanks. I'll start looking for it.
Claudia
GA US - Wednesday, March 26, 2003 at 12:19:24 (PST)
Claudia,
*Talk to Her* is being shown with subtitles and is well worth seeing. I thought it was beautiful and was thrilled to see that AR wishes to work with the Director. One to hope for.
Cindie
- Wednesday, March 26, 2003 at 12:06:11 (PST)
Suzanne, I don't even have the words to thank you for the videograms and links. I
found 'Sleep and Shadow'(a combination of Sheriff George and Rasputin, complete with
dancing... nay, cavorting!... on a tabletop!), Alan's appearance on the Conan O'Brien
show, and his appearance on The View. Admittedly, I imagine these take approximately an
eternity to download if one doesn't have a high-speed modem, and the quality is certainly
nothing to brag about. But for someone who had no prospect of ever seeing these things,
it's so thrilling! I need to find someone with these things on non-PAL videotape who is
willing to share! I also want to say thank you from the bottom of my heart to those who
reported on Alan's appearance at 'Collateral Damage'. I had been so longing to hear about
it. I am grateful beyond measure. VimesLady
VimesLady <VimesLady@attbi.comfoo>
Seattle, WA USA - Wednesday, March 26, 2003 at 11:38:43 (PST)
Hello everyone. Just surfacing up for air after being buried by work. I wanted to send out a few late responses.
MP: Thank you for putting the transcript out here. It was a great read. AR is quite gracious isn't he?
Gissing's Girl: Where did you find the Snape mug? I'd love to have one! Also, thank you for the lovely comments on my fic. TwtBD. Please feel free to print what you like.
Dee: in response to your query, my favorite AR character to spend time with would
either be the Sheriff or Snape. I just love the bad boy.
white raven
Houston, TX - Wednesday, March 26, 2003 at 10:47:46 (PST)
Doing my daily (when I can get to it) must-be-far-too-cursory scan of the Guestbook.
Love the transcript, thank you mucho to whomever sat down to type it up! Question: is
there anywhere this is *watchable*? ..and just for the record, since I haven't posted here
in forever, I am also a giant Snape fan and have been a premier Snapologist on our Harry
Potter site for, oh, over two years.
Amanda "two in one day! wow" <editor@texas.netfoo>
San Antonio, TX - Wednesday, March 26, 2003 at 10:18:32 (PST)
MP, thanks for the lovely interview transcript, it made me smile.Dee I think there
is no contest there, I'm older than you, although I will let you have a go when I've had
enough(is this possible). Sins become more subtle as you grow older, and this will surely
be a SIN!
Gissing's Girl
UK - Wednesday, March 26, 2003 at 09:53:04 (PST)
Barbara the Australian--I never thought you were being rude--I was glad to read your
comment! :) I just found a copy of TRotN, 2 big red and white boxes full of tapes. Can't
wait to get them out to the car and into the tape deck!!!
Lee
- Wednesday, March 26, 2003 at 09:39:19 (PST)
Fausta, are you mailing the Review out again? I used to be on the list. If you are,
I'd love to get it again! Or do you just do monthly updates on the site?
Amanda, working full-time and falling behind on Rickman stuff!!! <editor@texas.netfoo>
San Antonio, TX - Wednesday, March 26, 2003 at 09:31:32 (PST)
A very big thank you to Pamella Bisson for showing AR Diane's Seduction Menu! I do hope everybody realizes that the recipes are sent by people who want to share recipes and they have not been tested on AR. They are part of the Rickmanista Review mainly because that's the only site I run (except for work).
MP, I'd like your permission to post the interview in the April Monthly Rickmanista.
Please let me know. Thank you,
Fausta
- Wednesday, March 26, 2003 at 08:22:14 (PST)
MP- Thanks for the interview..it was a pleasant way to start out my day!!
I can say that I have also read all 4 of the Harry Pooter books. After finishing Book 4 I had to do the pre-order on Book 5, my daughter thinks I'm getting the book for her. WRONG!!!
I too have read alot of the "rumors" that are associated with the remaining books at a few sites.
Oh well kids are trying to kill each other now...got to love spring break. Everyone
take care.
Tina
Chicago, - Wednesday, March 26, 2003 at 08:12:20 (PST)
Oops! One more thought. I know The Man speaks fluent French but had no idea he spoke
(or at least understands) Spanish! Hmmmm, never would have thought after Jamie's
"terrible accetn"!
Claudia
GA US - Wednesday, March 26, 2003 at 07:45:11 (PST)
Another thought or two on the interview: I thought it was really cute how AR skirted the question about his favorite director. NEVER burn your bridges, I say! LOL
Also, his bringing up the Spanish director Pedro Almodovar was very interesting.
"Talk to Her" has been a huge success this year. Almodovar won a European Film
Award, a Golden Globe, and an Oscar...sorry I could be wrong but I don't think there was a
BAFTA for him...but he has won big the past few months. Now I want to see "Talk to
Her" Wonder if we can get it with English subtitles! I do hope Almodovar gets wind of
AR's comment!
Claudia
GA US - Wednesday, March 26, 2003 at 07:42:01 (PST)
After reading that interview with AR, I am even more mad about him--didn't think it was possible. Thanks MP.
Yes, whatever Moritanna's been taking, I want some.
GG, I think you'd have to let your elders go first :)
Dee
- Wednesday, March 26, 2003 at 07:24:19 (PST)
Hello, everybody!
I'm back from Sherwood Forest where I spent the last two days (My husband brought the
video from a business trip to England and I watched it in English for the first time!!)
Alan's voice is so refined (Is this the word?) that he nearly has to exaggerate to make
his Bad Guy believable. I loved every scene with him and still have a big smile on my
face!!
Oh, by the way: Kevin Costner has no voice at all!! His German speaker sounds much better!
(Now you can see how I am devoted to voices!)
Ulrike
Germany - Wednesday, March 26, 2003 at 07:13:38 (PST)
Oh oh... Massachusetts/New England posters here? Better keep my answers generic as
I'm in NE too :-)
CJ
- Wednesday, March 26, 2003 at 06:05:56 (PST)
And furthermore........... I thought it was a blast to have AR look-in on Fausta's Rickmanista
Review during the recipe segment of the interview! Well, Fausta! That must have made
your day! Week! Year! LOL :~)
Constance
- Wednesday, March 26, 2003 at 05:39:30 (PST)
What an awesome interview!!!!!!!! Thank You MP!!!! I laughed and smiled through the
whole thing and now my face hurts!!! So......... he is a little bit married ? That
was so sweet!!! and he did not correct her when she asked if he cooked with his wife. Dear
Rickman (sigh!), not wanting to corrupt the minors! LOL (no offense, you understand ;~))
Anyway, thanks again. That surely made my day! Oh, btw; when did this interview occur?
Constance <madaboutron4@yahoo.comfoo>
Cary, NC USA - Wednesday, March 26, 2003 at 05:27:32 (PST)
Claudia, I agree with you on AR's comments about award shows. In a way they are just
one big advertising campaign.
Sabine
GA USA - Wednesday, March 26, 2003 at 05:05:16 (PST)
Mortianna: You really shouldn't drink so early in the day! LOL
(You could lose your flying permit)
MP
- Wednesday, March 26, 2003 at 05:00:02 (PST)
Clear the runway! rather: ccclose the gate! which I will do now, promise*keep
fingers crossed* as to cocky - sorry, haven't got the equipment for that.
mortianna
show-off, yes, but it works, or I'll eat my rat - Wednesday, March 26, 2003 at 04:56:55
(PST)
Thanks MP for the wonderful interview. And wasn't he just the gracious person to the beginner interviewer! Just solidifies why I like him so much!
Funny, I have always had a feeling The Man didn't think a whole lot of awards and such.
He hit the nail on the head.
Claudia
GA US - Wednesday, March 26, 2003 at 04:50:02 (PST)
MP, thank you very much for the transcript. I could not open it on the original
site. He is just the best. This was a nice way to wake up today and be greeted by this
interview. WoW!!
Juliana
- Wednesday, March 26, 2003 at 04:32:15 (PST)
"Plane in your brain"???? well that explains it then!! Clear the runway!
BTW WE are getting cocky with all these italics aren't we??LOL
Sue
- Wednesday, March 26, 2003 at 04:00:21 (PST)
abd? what does that mean? who typed that? did it come from outer space? or from some
plane in my brain where that makes perfect sense? I blame the government
mortianna again
the answer is 42., BUT - Wednesday, March 26, 2003 at 03:50:26 (PST)
Sue that's because I was in New York, too, which was later than London, I
think - but you can go to London all the time*sniff*. the original, as I remember, goes
like that: have I annoyed you by saying that? just a little. can you hear him now? though
I have to admit, my first remembrance went to the wrong part. I thought it was his answer
to Lindsay's "that was the first time you struck me". But I think the answer was
slightly different - and the tone was too:-)
mortianna
jumping on every opportunity to remember, abd it WAS funny - Wednesday, March 26, 2003 at
03:46:37 (PST)
MP - Thanks for the transcript. Mortianna, you obviously know your PL script better
than I do!!!I just thought it was a great comment.
Sue
- Wednesday, March 26, 2003 at 03:38:51 (PST)
MP - thanks for the transcript. he seems to know the lines of Private Lives well
enough: are you married? - just a little. that made my day - I'm full now of images
of Pl.
mortianna
mad enough to own a Snape figure, but NOT playing with it - Wednesday, March 26, 2003 at
03:26:22 (PST)
DEE, we'll have to have disposable dishes as we'll be too busy fighting over Snape's
favours to do any serious washing up. Mind you he could use his wand to clean the kitchen
and then use it for more interesting things! Whose going to be first in line?
Gissing's Girl
UK - Wednesday, March 26, 2003 at 02:58:56 (PST)
A friend sent me a transcript of the YCTV interview AR did in late 2002. Here it is. Remember that the interviewer is a student in her late teens.
PB: Hello. My name is Pamella Bisson and welcome to Cinemania. Im honoured to introduce our special guest today who is a renowned British film and theatre actor who has been on screens and stages if I can say it? - 24 years? Mr. Alan Rickman. Hi how do you do?
AR: Good, thank you.
PB: How have you enjoyed your tour?
AR: Terrific. I was just saying youre very lucky we had nothing like this a little more than 24 years ago.
PB: Alright. Were going to start as we need to go on. And I want to ask you what questions do you hate being asked the most?
AR: It depends whos asking them, really. I dont mind. You can ask whatever you like.
PB: Okay, alright. Everybody knows that Harry Potter has obviously been a great success in the UK, America, its taken over the world. How do you feel being a part of it?
AR: Im very proud to be part of it. Because, you know, its not often that something comes along thats become somehow a part of the worlds currency and vocabulary and that has made such a huge difference to the lives of so many children. Theres this phenomenon called Harry Potter thats encouraged kids to read again.
PB: Have you read the books the Harry Potter series?
AR: Well, Ive read the ones that are out. Obviously, you have to read them before you go make the movie otherwise you might make a big mistake.
PB: How did you get the part?
AR: I was asked and then I met with the director and then we kind of both decided okay.
PB: Does it disappoint you then that you havent been made into an action figure?
AR: Ah-I have one at home, so I think I have.
PB: You have? The internet says you havent.
AR: Yeah, oh no, Im there. You can buy a Snape doll if youre that insane.
PB: A third Harry Potter movie comes out next year. Are you going to be a part of that, as well?
AR: I hope so, yeah, if it all works out. I was talking to the director last night. Because, you know, its a new director for the third one and this ones called-this one!-this person is called Alphonso Cuaron. Hes a Mexican but he is a brilliant director.
PB: Was there a different director for the first one as well as the second one?
AR: No, that was Chris Columbus who directed the first two. He will be producing this one so he will still be there.
PB: Will you be in the fourth? The fifth? The sixth?
AR: Oh, who knows. The fifth one she hasnt finished writing yet.
PB: Richard Harris who played Dumbledore in the last two Harry Potter movies and has recently passed away is that going to have a big effect on the next movie?
AR: Yeah, I think its already having a big effect. You know, it was kind of very sad at the premiere. Im sad in one way and glad in another because he has quite a lot to do in the film and so you get to see him for this last movie. He was a wonderful man wonderful actor. And, Ill miss him because we used to sit next to each other in the make-up chair in the morning chatting away, or he would be dozing in his chair because it was early in the morning. And, he was a great guy. It will be a big difference and I dont know who its going to be.
PB: That was going to be my next question-
AR: Oh, no, I dont know.
PB: We also know youve been I a couple of films that have not yet been released. For example, Love Actually?
AR: Not only not released yet, its not finished yet! Its still shooting. Ive been filming on it the last month or so and I still have a shot to do on it and then I think it will be released next Christmas.
PB: Can you tell us a bit about it? The plot? The character?
AR: Well - Its written by Richard Curtis who wrote Notting Hill and Four Wedding and a Funeral. And, this time hes directing for the first time. Its about maybe six different couples and they each have separate stories and you jump about from one couple to another other. Then, right at the end of the movie all the couples come together a school Christmas concert. There are links- there are certain links.
PB: Talking about directing movies - the first movie that you directed was The Winter Quest?
AR: The Winter GUEST
PB: Guestsorry (giggling)
How was it directing that film?
AR: I loved it. The good thing about directing a movie is that youre surrounded by so many experts. Its very reassuring. You show up on the set and everyone knows what they are doing.
PB: Do you prefer that to acting?
AR: No its not that but now its a part of my life and I will do more. But its a question of organisation. If you decide to direct a movie you know and if the fates are with you to get your money, which is very difficult in this countryyou know its at least a year maybe eighteen months of your life you can just cross off the calendar.
PB: Theres also been some rumours that youre starring in a new film of Sherlock Holmes?
AR: Not true.
PB: That was on an unofficial website.
AR: Thats one of those weird things. I dont know where they make it up from.
It may be though, and this is how the film business works, that there is a Sherlock Holmes film that somebody wants to get the money for and they start to put things out on the internet.
PB: Would you do a Sherlock Holmes role?
AR: Probably not. Because I did play him once in the theatre and its very proscribed that character. Theres not much you can do with it. I should never say never because who knows what the script might be.
PB: Youve also won the Golden Globe for Rasputin? (If I pronounced it right)How important are awards to you?
AR: I always think its an ungodly (?) idea winning and losing in acting. It doesnt seem to me that its a job that should be competitive - its hard enough. For the people who sell the films its important to them. If you think of an awards show its free television and they get lots and lots of very famous people to show up unpaid. Now, of course, what theyre doing is theyre wearing the clothes of famous designers. The designers get their clothes advertised. Its a great big way of selling two industries. Its very nice when people appreciate your work, but you shouldnt really take that side of it too seriously.
PB: On a lighter note, do you know Mel Smith personally?
AR: Very well.
PB: Was he at school the same time as you?
AR: No, but weve know each other very well for a long time.
PB: So you couldnt tell us any naughty stories?
AR: Mel Smith is a very naughty person.
PB: Remember its kids tv.
AR: Hes a very naughty person. Hes also a very talented person. I wouldnt want to do anything which shook your view of him.
PB: Which do you prefer- the film or the stage?
AR: You can be very happy and very miserable in both of them. I just finished a year in a play so Im very happy now to not be doing a play. Because its every night, its seven shows a week and its 21/2 hours every night and that gets to be pretty exhausting.
PB: What play was that?
AR: Private Lives. I did it in London for five months and in New York for five months. Its good to not be on stage but I think it would probably be good to get on stage in six months or so.
PB: Have a change?
AR: hmmm.
PB: What do think of the British Film Industry?
AR: If we had a film industry properly, if people would take the risks and fund it. The British film industry is the one that didnt fund Harry Potter its American. So there you have an example. Whoever the forces are werent brave enough to find that kind of its a huge amount of money. But pretty damn safe bet. So youd think maybe some smart banks would have got that together.
PB: Whats the difference between acting on stage and on film?
AR: Not a lot, I dont think. They sometimes say that acting on stage is like painting in oils, and acting on film is like painting in water colours. The big difference is, of course, is that in a play you start at the beginning and you work through the middle and then the end. Every night thats the line that you draw. On film, of course, its shot out of sequence so you have to have in your head a very strong sense of the shape of the story because you might be shooting, as I did on Love Actually, I shot the last scene first.
PB: Whos your favourite director?
AR: You cant get me to say thatsay one and you offend somebody else. I tell you whatI just saw the film Talk to Her by Almodovar. Hes a Spanish director and Id like to work with him.
PB: What films had he done?
AR: Trouble is I know most of his films in Spanish. The new film is called Talk to Her in English.
PB: When an actor or actress has been in as many films as you Alan Rickman do they actually remember all of their lines?
AR: While youre shooting?
PB: No, I mean years later-do you actually remember any of your lines?
AR: The first thing you do is as soon as you finish any job is remove any knowledge of those lines from your head.
PB: Well, we actually have a Challenge Quiz for you.
AR: You do, well, Ill fail it, Ill tell you now.
PB: We have a budding actor, Mr. Nana Wilson, who has chosen some of his favourite quotes from your movies.
AR: And I have to guess which film it was?
PB: Yes you do and if you do, you win a prize.
AR: Whats that?
PB: Its a date with my mother because she absolutely adores you.
AR: Oh, okay.
PB: Are you married?
AR: Just a little.
The Challenge Quiz:
1. If it hasnt been made into a movie it isnt worth knowing about is it?
AR: Close My Eyes or Truly Madly Deeply
Answer: Dogma
2. Ill cut your heart out with a spoon.
AR: Prince of Thieves, I know that one.
Answer: Correct
3. Thanks
AR: It cant be Sense & Sensibility because it would be Thank you. Ill say Dogma.
Answer: Galaxy Quest
4. Experimental weapon with experimental ammunition.
AR: Die Hard
Answer: Quigley Down Under
5. Youre most troublesome for a security guard.
AR: Die Hard
Answer: Correct
6. Do you really think you have a chance against us, Mr. Cowboy?
AR: Die Hard
Answer: Die Hard
7. My mother does not have a beard.
AR: Truly Madly Deeply
Answer: Truly Madly Deeply
PB: Well Done!
AR: Well done?
PB: Even though you didnt get them right you still have to on a date with my mother. I promised. Sorry.
AR: Okay. Thank you.
PB: Now moving on We found a website something on the internet. Cookbooks -- Lists of Recipes. Weve got some interesting recipes here and I was wondering can you cook?
AR: Yeah - ish.
PB: Are you a good cook?
AR: Well, Im alright.
PB: Do you cook for your wife?
AR: We cook together.
PB: Have you ever cooked Chile Lime Shrimp.
AR: Never.
PB: Well, weve got some recipes here and we want you to try them out and wed like you to give us a call and tell us how it went.
AR: (Looking over recipes) Okay. Its a Seduction Menu? Oh I see.
Whats that website? Is that supposed to be things I like?
Ed. Note: Link to website they were looking at: Seduction Menu
PB: Yeah. It says your name and many different types of foods and dishes by your fan. Your fans and critics wrote what they thought.
AR: (Squinting at website on interviewers laptop on desk)
PB: Okay, just to finish offa bit in the paper today. Theyve actually made a game console on Harry Potter. Did you know that? Do you have a Playstation?
AR: No.
PB: Your kids dont have one?
AR: I dont have any.
PB: You didnt get the game free?
AR: No.
PB: I have surely enjoyed this interview today and it was nice for you to come over. I hope you had a nice time.
AR: Thank you. You were great. You get the job.
MP
- Wednesday, March 26, 2003 at 02:34:34 (PST)
Hi everyone in the escape from reality or is it too reality I have reborrowed HP from the video library where I have also found Judas Kiss, I shall be checking out the New Idea and hassling Big W for any A.R. videos on sale. I have emailed people and hope they are feeling talkative as I like getting to know the real people here. I love this page yet alas my DH is hogging the computer, well he does need it for homework and so it takes ages to read all this fun stuff. So I will go and sulk with my videos. Has anyone else draped black scarf around the telly to see different incantations of Snape or am I the only really desperate one here? Slope makes a good seductive slimy Snape.
Who would you spend time with hmmm I would love the magic and "need to be
released" Snape yet not having seen Mesmer or AABA The only A.R characters that I
know of to be romantic are Jamie(give him a shave) and the Col so not being one to share.
I will just have to be gallent step aside. Or I might just have to rotate them I mean each
character per day of all of the A.R. characters. So how may days would it make? I mean how
many characters has A.R. done. Who can concentrate well enough to count?
Janine(whose imagination cannot just pick one)
Melb , Vic Australia - Wednesday, March 26, 2003 at 02:23:09 (PST)
This may be coming a little late, but Marianne De Grave, you might want to check out Claire's off-topic discussion on the war--many viewpoints there and all AR fans--> http://home.freeuk.net/sc.i/offtopic.htm
Has everyone gone off to bed???
Dee
- Tuesday, March 25, 2003 at 23:01:28 (PST)
CdC--I believe you are the only woman I know who owns a chicken head. Uh, that is
your chicken head is it not--or have you just been practicing transfiguration on your
muggle neighbors?? Let me get my boyfriend, Severus, to help you out . . . (and you keep
your hands off of his frock coat, buttons, and wand!!)
Dee
- Tuesday, March 25, 2003 at 22:43:28 (PST)
Alrighty then--I met with fellow GBer, Anne, tonight as she was here in my neck of the woods for a visit with her family. It was fabulous!! Not only is she great, but so is her entirely friendly and rather enormous family--mothers, fathers, aunts, uncles, cousins, children, etc!! A beautiful home too! At one point her husband came over to chat and asked us if we were talking about "Alan Ruckman" (no that is not a typo). And, yes, we were!!
Saturnine, I am so going to visit with you in June (no snow please!) and if you have Tivo--I may never leave (uh, I won't do your dishes either--I think I have to do them when I visit Gissing's Girl).
Kate--ah, another MA-an. I knew there was something about you I could relate to.
Now, here is my "The Search for John Gissing" report . . . I have written an email to Mike Binder about this movie. I confessed that there is a large contingent of AR fans dying to see this flick (was I wrong to tell the truth?) Will report back if I receive any return message.
Um, Sabine? What is "real life" again???
Dee
Pasadena, CA US - Tuesday, March 25, 2003 at 22:21:14 (PST)
Kate-Yes! I love autumn, that's what I would miss the most, it's my favorite time of
year. However, this week was the first time I've been able to go outside without the whole
jacket, scarf, mittens getup, and it sure was nice. As for snow, I *think* I miss it, and
then I suddenly find myself up to my eyebrows shoveling at 5 am, and wonder what the heck
I was thinking! Sabine- You've sold me on TiVo! The thought of multiple potions master
sessions has pushed me over the edge. Must harass the husband once more before hitting the
hay. Have a nice night everyone..
saturnine
MA - Tuesday, March 25, 2003 at 20:50:39 (PST)
Hi Guys! I haven't posted in a long time. Had to pay attention to real life for a change. :-) But now I've had some time to at least scan through the GB and I just have a couple of comments.
Saturnine: I'd definitely recommend getting a TiVo. I have one and I absolutely love it! Not only can you set up actor wishlists, but you can also set up keyword lists. So, if you chose "Harry Potter" as your keyword, it'll record anything HP related.
And one more thing.... Kevin Who? LOL
Sabine
GA USA - Tuesday, March 25, 2003 at 19:56:25 (PST)
Dee, Saturnine: I;m an old Massachusetts girl myself, now in California! Miss the
East only in autumn...
Kate
San Francisco, - Tuesday, March 25, 2003 at 19:13:26 (PST)
Well, I'd definitely sign up for a Kevin Costner Concientious Objectors Group. He's
just wrong! DEE- Okay, now you've forced me to confess how pathetic I've become. I'm
begging the husband to get us TiVo, because my friend has it and you can set up lists by
actor (!) and then it records everything that they appear in. Multiple times if you want!
You can see where this will lead, don't you? Forget dishes, I'll never leave the house
again! :) If you're coming in June, maybe we'll have to have a little AR coffee get
together ourselves.I can't find anyone here to support my habit, it's very sad. How are
you liking the west coast in comparison to back here? I've always had this fantasy of
escaping the snow.
saturnine
MA - Tuesday, March 25, 2003 at 19:12:28 (PST)
Saturnine--you think you're bad, I, um, have my calendar marked for the month with all of AR's movies on the cable channels I get. One of these days, I'll do the dishes . . . BTW, I'm a transplated Easterner--New Jersey and Amherst, MA. My ma still lives out there. I'll be visiting in June.
CdC, I'm going to go do some of your puzzles right now . . . that chicken better look like AR.
Gee, and here I was, all set to start a Kevin Costner fan club!!!
NOT!
Dee
CA - Tuesday, March 25, 2003 at 18:21:36 (PST)
MP, thanks for the link to the interview. Did you get to se the interview by chance?
What was it about? Thanks~
Susan
- Tuesday, March 25, 2003 at 18:07:33 (PST)
I'm going to try that link to the YCTV website again: Alan Rickman YCTV
MP
- Tuesday, March 25, 2003 at 17:48:21 (PST)
Hey....Did anyone see the YCTV special featuring the interview with Alan?
Here's the link to the YCTV website which mentions the interview: YCTV AR Interview
Noticed while perusing this website that Rima Horton sits on the YCTV Board of Trustees.
MP
- Tuesday, March 25, 2003 at 17:43:21 (PST)
Here's the Hello! magazine news bit from their website that Sue (?) mentioned:
25 MARCH 2003
Harry Potter author JK Rowling is celebrating the arrival of her second child, after giving birth to a healthy baby boy in Edinburgh Royal Infirmary. It is her first child with husband Dr Neil Murray, whom she married on Boxing Day 2001.
Her nine-year-old daughter Jessica is also overjoyed at the news of her new brother. "Both mother and baby are doing well," said the millionaire writer's publicist.
It looks set to be another big year for the Rowlings, as the fifth Harry Potter book, The Order Of The Phoenix is to be released in June and a third movie, The Prinsoner Of Azkaban is also in production. Emma Watson, John Cleese and Gary Oldman will all be appearing in the film, with 13-year-old Daniel Radcliffe reprising the lead role.
While a pay dispute has caused a temporary delay in the production of the latest blockbuster, producers expect it to be released early in 2004. It will have its work cut out to match the success of the previous two movies, Harry Potter And The Chamber Of Secrets and Harry Potter And The Sorcerer's Stone, which grossed a phenomenal $1.7 billion worldwide.
MP
- Tuesday, March 25, 2003 at 17:38:24 (PST)
My vote is with you for worst actor in history. Watching Kevin Costner act is worse
than watching paint dry. Calisthenics on Maid Marian-hee,hee! That's great! Some girls
have all the luck, aye?
Saturnine
MA - Tuesday, March 25, 2003 at 17:36:04 (PST)
Marlana and Troy08-hello fellow nor'easters! :) I'm glad I'm not the only one out
here. A small world, my parents live in southern NH-Windham and Derry, and I have family
in Lewiston and Sabattus, ME. Marlana, don't forget those delicious robes hiding all sorts
of delights! Yes, I love those bad boys..Judas Kiss isn't my favorite either, I tend to
turn the mute button on until our man hits the screen. Even then the southern accent tends
to hurt a bit. As you can see, I managed to post again, which means my husband put away
the straitjacket-for now!
saturnine
MA - Tuesday, March 25, 2003 at 17:29:05 (PST)
Actually--it's spelled: SALMA HAYEK
xxxx
- Tuesday, March 25, 2003 at 17:03:38 (PST)
As I sit here trying to watch RHPOT on Encore right now, I'm reminded of why I can't
fast forward thru this turkey fast enough. AR is the only thing in this movie that's ALIVE
for cryin' out loud! "You -- my room, 10:30 tonight. You -- 10:45! Bring a
friend." When he's onscreen (for 30 seconds every 20 minutes), I;m laughing with
tears running down my face. Then Costner lumbers back like Robin of Malibu and it's
zzzzzzzzzzz. Is Costner the worst actor in history? I say yes! Resoundingly! Luv Kev's
hair in this movie too -- so Hair Club for Men. Oh, the things we do for AR ... "No
more table scraps for widows and orphans! No more merciful beheadings! And call off
Christmas!" Oh, the Man is a genius. Wake me up when he does his calisthenics on top
of Maid Marian ...
Kate
San Francisco, - Tuesday, March 25, 2003 at 17:02:13 (PST)
Typo there-Thats SELMA Hayak.
Troy08
- Tuesday, March 25, 2003 at 16:22:29 (PST)
I am also an East coast Rickmaniac-Southern Maine. Someone mentioned how they liked everythng but Judas Kiss. I watched it again the other night-it really isn't that good of a movie. I liked Alan in it, but the plot sort of rambled. Also, if a millionaire computer software designer(a la Bill Gates type)really were kidnapped, they would certainly have more the one federal agent workng the case.Those fake southern accents always make me laugh.
And on an AR related topic-did anyone else think that Selam Hayak was simply the most
beautiful woman at the Oscars the other night. There were many lovely ladies that rated an
A for fashion sense(Kidman, J.Garner, Catherine Z-J,Zellwegger)but only Selam rated an A+.
And on the flip side, my D grade went to J.LO. Not a good lok for her.
Troy08
Lewiston, Me - Tuesday, March 25, 2003 at 16:20:57 (PST)
The website for Hello Magazine is reporting that JK Rowling has given birth to a
healthy baby boy. That's great news. Also says that production of the HP movie has been
delayed due to pay disputes. The article doesn't go into detail about that.
Susan
- Tuesday, March 25, 2003 at 16:13:16 (PST)
saturnine, I am an east coast Rickmaniac, southern New Hampshire actually. I love
just about everything I've seen AR in (except Judas Kiss), but I've always had a weakness
for the Sheriff and Snape. Something about wearing black, boots, swords and wands. Hmmm.
marlana <iammarlana@yahoo.comfoo>
NH USA - Tuesday, March 25, 2003 at 16:05:12 (PST)
Sigh! Here I am in the best-yet-worst quandry. I'm trying desperately to get some
work done, and what do I find but Robin Hood on Encore, and Harry Potter on Max at the
same time. So, instead of getting anything accomplished, I'm switching back and forth
between the two like a maniac so I don't miss any AR. My husband is looking at me like
it's time to get out the straitjacket. Which it well may be.. I can resist the urge to
watch my own DVD's but cable is the devil! pity...clearly....fame isn't
everything...almost dropped my books and my laptop on the floor. Darn that Snape! It's a
hazard to try watching the potions master while you type, or anything else for that
matter. Love the guestbook, hope you don't mind the foray out of lurkdom. Just curious,
are there any east coast rickmaniacs out there?
saturnine
Spring-has-sprung, MA - Tuesday, March 25, 2003 at 14:33:55 (PST)
OFF TOPIC, Julia from Canada, your CD is on the way. I've E-Mailed you a couple of
times but they're not going through for some unknown reason. E-Mail me if you read this.
Thanks
marlana <iammarlana@yahoo.comfoo>
NH USA - Tuesday, March 25, 2003 at 14:25:09 (PST)
Dee, he is only a rather greasy fellow because we have been conditioned to think
so,don't forget that in most of the fanfics he has glamoured himself to look like this to
the outsider. Obviously you/me and CdC have been "Snaped" and can see beyond
this. Ali-Pat glad you got the package and it brought you some fun, let me know if you
hear of any magazines etc that you want
Gissing's Girl
UK - Tuesday, March 25, 2003 at 13:06:06 (PST)
CdC I CAN'T believe I have just spent 8 mins doing a chicken puzzle!!! LOL Sad or
what!!!??
Sue
- Tuesday, March 25, 2003 at 09:44:54 (PST)
CdC I must be being particularly stupid tonight as I can't access any of your
jigzone pictures. I thought it would while away the time until 7 o'clock as I've only got
3 students in.
Gissing's Girl <atworktryingtoaccessjigzonewithoutsuccessfoo>
UK - Tuesday, March 25, 2003 at 09:41:55 (PST)
Which AR character would I like to spend a day with? Welllll... It would be a toss-up between Sinclair and O'Hara. With Sinclair, I wouldn't get a word in edgewise, but at least I would eat well. And with O'Hara, I suppose I could talk him into lending me one of his coats (the leather one, I think) before we took a ride on his motorbike.
Excuse the following personal post, but I have only sporadic access to my home computer
these days. Carolyn--loved the card and peace to you, too! Gissing's Girl--I received your
package yesterday and I am overwhelmed with your thoughtfulness. You are both day-makers.
Ali-Pat
Dayton, OH USA - Tuesday, March 25, 2003 at 09:40:27 (PST)
CdC, green is perfectly acceptable as it is my favourite colour and I wear a lot of
it albeit in different shades. We could co-ordinate our robes, would go nicely with his
black!. As to DH's frock coay perhaps you could sew some (lots) of buttons on. Lots of
practising with the wand to unbutton them. Dee, hope you also are having a good Snape day.
I'm currently waiting for a Snape mug to be delivered and felt like mugging the postman
this morning. Oh well there is always tomorrow. I've just remembered I've been working
with a wand for the last 10 years as that is what we use to put security tags down the
spines of books. Perhaps I don't need so much practise after all. Iwonder if it would be
worth writing to AR's agent to ask about the release date for The Search for John
Gissing.Think I'll try that as well as the emails to Mike Binder(no reply yet)
Gissing's Girl
UK - Tuesday, March 25, 2003 at 09:24:43 (PST)
Back from another plane of existence, I bring to you...moi, heroical & chickenly in my very practical green robe
Heroical & Chickenly in Robe
http://jigzone.com/ms/z.php?ui=297688i762369&z=67_piece_classic
Carolyn, dear Carolyn <againfoo>
CO USA - Tuesday, March 25, 2003 at 08:27:36 (PST)
I'm sorry. I couldn't find any 'possum skins. I DID find a man in my back yard wearing a raincoat and a chicken mask. I'm wearing my robe today (green acceptable to the other Snape Wenches?) so I zapped that sucker into another puzzle, raincoat and chicken mask.
Texas
http://www.jigzone.com/ms/z.php?ui=297688i1845787511&z=51_piece_crazy
Snape Print 1
http://www.jigzone.com/ms/z.php?ui=297688i1845787777&z=50_piece_circles
Bollocks
http://www.jigzone.com/ms/z.php?ui=297688i1845787495&z=50_piece_tri_clip
Rickman in Rubber
http://www.jigzone.com/ms/z.php?ui=297688i1845784463&z=20_piece_classic
Jamie With Cello
http://www.jigzone.com/ms/z.php?ui=297688i1845792987&z=20_piece_classic
Raincoat & Chicken Mask
http://jigzone.com/ms/z.php?ui=297688i762334&z=80_piece_classic
Off Topic/Poppy, One of my Birds
http://www.jigzone.com/ms/z.php?ui=297688i494663&z=20_piece_classic
Statement
http://www.jigzone.com/ms/z.php?ui=297688i1845792948&z=44_piece_tri_dove
Carolyn, dear Carolyn
CO USA - Tuesday, March 25, 2003 at 08:15:25 (PST)
WERE not Where! Sorry! Still, where, were,what..I don't know where I am anyway
Sue
- Tuesday, March 25, 2003 at 07:04:37 (PST)
A Parallel Universe!?! And there was I thinking we Rickmaniacs where already ON
it!!!?LOL
Sue
- Tuesday, March 25, 2003 at 07:02:07 (PST)
What's with the whack spam??
BTW, you can download lots of fun AR images, video and audio from Kazaa.com. I got the Texas video and some AR readings: a Shakespearean sonnet ("My mistress' eyes are nothing like the sun . . .") and the Colonel reading to Marianne.
I hope everyone has a pleasant Snape/Colonel/PL/AR day.
Dee
- Tuesday, March 25, 2003 at 06:45:29 (PST)
When I finished HP and the GOB, my first thought was that Rowling was going to have Snape die a hero's death in the future. But then I thought, who would take the place of Harry's number one nemesis? I do not see her creating a love interest for him--or any other adult character ('cept maybe Hagrid)--as he is, essentially, a rather greasy fellow. (I am rather impressed by Rowling's creation of a character that appears evil on the outside, but is really rather decent on the inside.)
Kate, well so far you are the only one to keep the colonel's musket polished and cleaned . . .
Barbara--uh, thanks for sharing (snortle) :)
Dee
- Tuesday, March 25, 2003 at 06:38:11 (PST)
www.tonyboy.com IMAGINE if YOU WILL,the infinite possibility of a PARALLEL
UNIVERSE.Simuliar in design 2 the one we all inhabit.Now SURRENDER your IMAGINATION over 2
this CONCEPT,on the otherside there exist a COMPLETE OPPOSITE of YOU.living a different
LIFESTYLE than your own.but the 2 of you are FORGED TOGETHER on the EXACT SAME
DESTINY.Heading 4 the ULTIMATE CONFRONTATION 2 take place in a MAGICAL,MYSTICAL TERRITORY
called... DARK WORLD.......................... www.tonyboy.com THIS IS NOT A SPAM
MESSAGE,I APOLOGIZE IF YOU ARE NOT INTRESTED.IGNORE THIS E-MAIL(DO NOT RESPOND) THANK YOU.
www.tonyboy.com
TONYBOY 69 <ccoope1@nyc.rr.comccfoo>
NEW YORK, NY - Tuesday, March 25, 2003 at 06:32:24 (PST)
Gissing's Girl, "I don't think that JKR wrote the books with the thought of
Snape becoming a romantic hero" I'm glad you said that. I even mentioned to my DH
that, if the future books are not written, how could the the actual movies NOT change her
perspective of the characters? I mean, according to the books, Snape is a complex
character, but mean and hateful to Harry at the same time. In the film, he comes across
much, much different (and yes, sexy - which he isn't in the books). I'd find it hard to
believe the the author doesn't know about the, oh, million, websites devoted to AR and
Snape. Just my 2 cents :-)
CJ
- Tuesday, March 25, 2003 at 06:25:13 (PST)
Actually heard on the radio yesterday what the term "Collateral Damage"
actually means with regard to the War in Iraq. Collateral Damage = Civillian Casualties.
Please tell me I'm not the only one out there who didn't really understand what the term
was referring to!
Aussiegirl
- Tuesday, March 25, 2003 at 05:14:31 (PST)
Thanks Barbara, I'll email Arena TV and see if they'll play Mesmer again - fancy only running it once!
Dee, I have to admit I too enjoy reading HP to my son. He is dyslexic and has no hope
of reading them himself so I actually enjoy reading him a chapter a night just to catch a
"Snape" fix too (must be something about 44 year olds!). My husband has read
books 1-4 to him and I have done the same (we're currently 1/3 way through HP4). He loves
it when I put on my "Snape" voice for his parts and I love it too as I can just
hear AR saying the words! Little does my son know what's actually running through my mind!
Aussiegirl
- Tuesday, March 25, 2003 at 05:03:33 (PST)
Hello all, Aussiegirl, I did request Mesmer from Austar and they said they would
pass it on to Arena who showed it just the once. Will try again, and some other movies of
AR's - see how we go. The more phonecalls to Austar the better. Maybe worth a try? I'm
going to mention to them all the movie channels need to try. Have to agree with LEE, I
also like a healthy DRAFT around my unmentionables!!!!!!!!!!!! I'm not being rude Lee,
Blame HP4 the GOF!!!!!
Barbara the Australian <Hermione_3@hotmail.comfoo>
Gold Coast, Qld Australia - Tuesday, March 25, 2003 at 04:38:12 (PST)
CdC glad to hear from you- there is a sense of loss when someone you talk to
disappears for a few hours. That makes 3 of us who would like to be solidly sovereignly
Snaped, you,me and Dee. Dee I will send my email address today . Iwould have to go for
Snape also although my favourite AR character is PL O'Hara. I fell hard for him and have
watched AABA so many times that the tape is nigh to wearing out- not all fast foreward
either. It would have to be Snape- I too have read the HP books relishing even remote
references to the Potions Master. I think that I have read too much fanfic because I am
beginning to think that he is real. Sad or what!Hope book 6 is all about Snape, I don't
think that JKR wrote the books with the thought of Snape becoming a romantic hero
Gissing's Girl
UK - Tuesday, March 25, 2003 at 03:36:27 (PST)
To NATHALIE: For AABA, try www.bestprices.com. They have a new copy for $12.91 US,
which is CHEAP! They're very reliable and quick, I've bought stuff from them before. AABA
is only out on VHS by the way.
Kate
San Francisco, - Monday, March 24, 2003 at 21:10:07 (PST)
Dee: Does this mean I can have the Colonel all to myself? Yippee! I'll be the Lone
Musketeer! SNAPE SPOILERS: Anybody got any good ones for "Harry Potter & the
Order of the Phoenix"? I was surfing around looking for them (gods, I am a desperate
woman), but all I could find was that Book 6 (the one after OOTP) will be "Snape's
story" according to JK Rowling. A lot of speculation about him either falling in love
or dying a hero, or both. (and AR will be amazing in all scenarios, yes siree) Some
deluded souls think he's going to hook up with Hermione or Fleur Delacouer. I;ve read so
much fanfic that I'm warped, because the thought of Snapey in love with a young thing of
18 is not weird at all to me. But I gotta say, if you step back and look at it from JK
Rowling's admirably child-friendly perspective, that's a tad icky, considering the fact
that AR will be 60 or so by the time book 6 gets filmed. Any love interest would have to
be at least 40 to keep things in the ballpark of respectable. Emma Thompson comes to mind,
although when I try to picture her as a witch, I see her floating down on an umbrella like
Julie Andrews in Mary Poppins. Which leads to a disturbing image of Snape wearing a
striped jacket and straw hat like Dick Van Dyke. But that's another story...
Kate
San Francisco, - Monday, March 24, 2003 at 20:58:54 (PST)
I've posted quite enough here for tonight. However, I just needed to tell you all
that, as I write this, I am downloading the Texas in Demand video from Kazaa. Oy! AR looks
so fabulous. If anyone wants me to email it to them, I would be happy to do so (if I can
figure out how to do so).
Dee
- Monday, March 24, 2003 at 20:53:14 (PST)
Well, aren't we women funny, always needing to keep tabs on folks . . . now where is
that Aussie Girl?
Dee
- Monday, March 24, 2003 at 20:39:27 (PST)
Carolyn: Thanks for the badminton stamp! I'm using it on almost every score sheet I
can find!! You're so wonderful!
Sonoma: I'm glad you liked the CD! I received Robin Hood in the mail a few days ago. Are
you sure it was an ex-rental? It's in perfect condition! If you ever need anything, don't
hesitate to email me~
Shizuka Dream <shizukadream@yahoo.comfoo>
- Monday, March 24, 2003 at 18:45:21 (PST)
Now I KNOW I post too much. I'm quiet for a few hours and they send out a search crew. DH and I took a field trip to the big city--okay, the big-in-comparison-city, Denver--for some unfresh air today. The Tattered Cover Book Store had only one copy of THAT BOOK [I just wanted to see it, honest] but they were holding it for some other desperate Rickmaniac and they wouldn't even let me touch it! So, I'm back, I'm still pure.
And Dee, you are too kind. And Dee again, I think I'd liked to be severely sovereignly solidly Snaped several times...daily...and Sundays. DH is home this week and I'm eyeing a new black robe for him at the local necessities store. But, damn it, they have no frock coats!
Gissing's Girl, I didn't get your email, but now I have your address and I will contact
you soon. Thanks!
Carolyn, dear Carolyn <home,homeandderangedwherethebeerandthecantaloupeplay@home.comfoo>
CO uSA - Monday, March 24, 2003 at 18:44:03 (PST)
Gissing's Girl--will you send me your email address? I would like to send you a
note.
Dee <deebartholomew42@yahoo.comfoo>
- Monday, March 24, 2003 at 18:31:40 (PST)
Oh, hey! One more last item--I am meeting up with fellow GBer Anne! She is visiting
relatives in my "hood" and we are going to have a cup of coffee together on
Wednesday. I am very looking forward to it, and I will bring her some lovely AR pics that
we can moon over!!! This is such a fabulous GB!!
Dee
Pasadena, CA US - Monday, March 24, 2003 at 18:30:24 (PST)
Oh, one last item, I received the most lovely hand made post card from Carolyn, dear, Carolyn--with the image of her AR carving and a message of peace. She has great talent--and much kindness in her heart. Has anyone spoken with her lately??
CdC--if you are there lurking about, thank you so much.
Dee
- Monday, March 24, 2003 at 17:57:29 (PST)
I loved the Sheriff and his beard and his moustache and his curly dark hair, and I hated that awful, huge gerbil beneath Jamie's nose! (Oh, I forgot, in "Dark Harbor" you can see AR's *nether* hair too!!).
Query, if you could spend the day with one, and only one, of AR's characters, which
would it be? As much as I adore the Colonel, I would pick Severus Snape. (Can you believe
I have actually read all the HP books just to hear more about Snape??? For Gawd's
sake--I'm 44!! What utter madness.) I do love those books though.
Dee
Pasadena, HomeSweetHome - Monday, March 24, 2003 at 17:51:58 (PST)
Nathalie, the American Amazon.com has the video of AABA. $19 US Also one of the
other GB members has given me a copy of AR singing the french ditty you tranlated for me
so if you want a copy just email me and I will send it on.
Carol <djanke@bigpond.net.aufoo>
Gold Coast, Australia - Monday, March 24, 2003 at 17:42:08 (PST)
Nathalie, I believe AABA is only available on VHS, not DVD. I found it on Amazon.com here: http://www.amazon.com/exec/obidos/search-handle-url/index=vhs&field-keywords=alan%20rickman&search-type=ss&bq=1/102-6365150-5387340
Hope you can find it.
Dee
US - Monday, March 24, 2003 at 17:38:57 (PST)
I'm desperatly seeking for AABA on the amazon.com but can't find it. Do anyone know
where I might find this film ?
Nathalie
Paris, - Monday, March 24, 2003 at 16:16:17 (PST)
When is a wand not a wand?
Willie Todger-Johnson
- Monday, March 24, 2003 at 15:54:27 (PST)
According to JKR in GoF wizards don't wear either boxers or briefs.
Lee
- Monday, March 24, 2003 at 15:53:41 (PST)
I have just let a big sigh of relief. Ever since the whole discussion about the war
in Iraq started I have been waiting for some action against it by British actors. Our
Flemish news had an item on the protest which came from a number of American actors, like
Susan Sarandon, and of course, today they showed us Michael Moore's brilliant speech
during the Oscars, but we heard nothing about British protest. So there I was, wondering
where Alan Rickman was when we needed him, when I finally had the excellent idea of
surfing to this site and checking what he had been up to these last few weeks. And now I'm
all happy again (well... as happy as anyone can be these days, that is...) and my faith in
mankind (or some lovely memebers of it) has returned :-) Thanks Alan ! Keep up the
excellent work...
Marianne De Grave <marianne.de.grave@consultant.volvo.comfoo>
Lokeren, Belgium - Monday, March 24, 2003 at 14:54:38 (PST)
Dear Ali-Pat, I cannot for the life of me find your email address! January Man
arrived in the mail today, and I thank you so much for that! We did not have mail delivery
for several days due to all the snow we received last week. Thanks again, can't wait to
watch~ Susan
Susan <autumnfall56@yahoo.comfoo>
- Monday, March 24, 2003 at 14:51:05 (PST)
Oh, NO, Sue will never speak to me again! :))
GML (no husband and no beard;)
UK - Monday, March 24, 2003 at 14:45:37 (PST)
Beard, 'tache, soul patch, clean shaven, I really don't care!!! LOL
Sue
Married to a beard, - Monday, March 24, 2003 at 14:36:42 (PST)
I'm breaking my promise already! But I just wanted to comment to GML and Nathalie
that the very reason I think the "patch" without a moustache would look good on
AR is that it would accentuate that lovely bottom lip and leave his magnificent upper lip
in full view. But I usually prefer him clean-shaven, as you do.
Ali-Pat
Dayton, OH USA - Monday, March 24, 2003 at 14:31:43 (PST)
I can believe this : GML today I was looking at different pictures of AR and was
thinking to myself that I didn't find AR attrative with a beard or even a moustache. I
love his expressive lips especially when he has this sort of half hard smile. It makes me
stumble each time I look at those pictures. There is something in the curve of his lips
that I find very sexy!
Nathalie
Paris, - Monday, March 24, 2003 at 14:18:25 (PST)
Facial hair, Gasp! I think I am a rational person, I have no particular physical male ideal and have fallen in love with short/tall/dark/fair/attractive/ugly men - according to their personalities - but never, never with one who had a beard. No idea why not, but there it is. Something about it must repel me sub-consciously! ;) Maybe because it hides the mouth and chin which I find the most attractive bits in a man. At least the most attractive bits I am prepared to admit to in public. Now if you have a bearded husband -or have a beard yourself :D, don't kill me - I have nothing against them in theory... But you see, I saw Robin Hood Prince of Thieves and Truly Madly Deeply in France when I was a teenager, and although The Sheriff and Jamie stuck in my memory as characters, I felt no attraction whatsoever (I guess the French voice dubbing didn't help). It's not until I saw him bare-chinned in Sense and Sensibility (here in England) with real voice and all that I fell over backwards (I still have the scar at the back of my head;). I enjoy enjoying him, and these damn beards/moustaches delayed the revelation by *years*, dammit! ;) Oops, I'm being shallow!
About the Peace concert in London last night, I can't go on at lengths about it here but yes, Judi Dench was indeed there (not in Scotland) and did sing 'Cabaret' (the famous "come to the cabaret" tune). Oh my God (and you won't catch me saying that often), did she sing it! She was aMAzing! (I already knew she could be funny, but I had no idea she could sing that professionally). A riot. Biggest triumph of the evening, the roof nearly came down under the applause.
And now what you really want to know... ;) - No, I didn't see Alan there but keep in mind I did not conduct a serious search, my eyesight is poor, my new lenses are wrong (I was sitting in the sixth row of the stalls and could not see the faces on stage clearly!), and I didn't see him last time I attended an event which I later found out he attended too. So we're none the wiser I suppose ;). All I can tell you is that if he wasn't there, he missed a very warm and fantastic event. Anybody interested to hear a little more about it can go to the Talking Shop page.
GML (too lazy to do a link)
UK - Monday, March 24, 2003 at 13:23:46 (PST)
Good Luck in getting any sense from the contact address at the Search for John
Gissing site. I emailed them back in October last year to ask if they would PLEASE release
it in Australia. I did get a reply which stated: The date and whereabout for the release
of this movie are as yet unknown. But at lease they did reply. Perhaps if we all email
them they might realise that we seriously do want to see it and soon!
Carol <djanke@bigpond.net.aufoo>
Gold Coast, Australia - Monday, March 24, 2003 at 13:15:03 (PST)
I like the facial hair discussion--so many interesting nuances to our favorite person!!! Indeed, I greatly enjoyed looking at Snape's hairy leg in HP!! ( And don't forget the armpit hair in AABA!!)
Will let you all know the results of my efforts re "The Search for John Gissing." GG--report back on what you learn.
Yes, where are you CdC??
Dee
US - Monday, March 24, 2003 at 12:53:47 (PST)
Having watched QDU last night, I must concede that you were right, Sue--AR's chin hair is very like a "soul patch". It's Selleck who has the Van Dyke. How I could manage to confuse things of this level of importance is a mystery to me...
In any case, I should like to see one of those cute little chin dusters on AR one day sans the accompanying moustache.
Ali-Pat (okay--no more about facial hair for the time being--I promise!)
Dayton, OH USA - Monday, March 24, 2003 at 12:31:44 (PST)
Does anybody know if AR appeared at that fashion show fundraiser in Scotland last
night? And if he did, details pretty please!
Kate
San Francisco, - Monday, March 24, 2003 at 11:01:22 (PST)
Sue: Many thanks for the link to the great site! Excellent clips of the ever
handsome AR.
white raven
Houston, TX - Monday, March 24, 2003 at 10:45:24 (PST)
Dee, no relation although would like to be! Ihave just sent 2 emails to sites on The
Search for John Gissing for information. Don't know if I will get any replies, hope so.
CdC are you ok, you don't seem as lively as usual.
Gissing's Girl
UK - Monday, March 24, 2003 at 10:26:08 (PST)
hey this is a really good website but you HAVE TO UPDATE IT!!!!!!
nancy <ngrickman@hotmail.comfoo>
winnipeg, - Monday, March 24, 2003 at 08:20:54 (PST)
Good luck in trying Dee....but WAKE up! LOL
Claudia (who hopes that Dee can make some headway in getting it released in some form!)
GA US - Monday, March 24, 2003 at 07:20:46 (PST)
Sue--ya, I did!! (Thank you for yet another lovely AR site!!) But, you see, I'm
going to write to the addresses provided at the Gissing site and see when, where and if I
can get a copy of the flick--even if not yet available to the gen. public. (P.S. Mind you,
it's early and I'm only half awake!)
Dee
- Monday, March 24, 2003 at 07:15:13 (PST)
I really like Alan Rickman. I mean, I really like Alan Rickman. My friends think
there's something wrong with me, but I'm perfectly sane. Alan Rickman should get an
honorary Oscar. Adrien Brody's acceptance speech was cute...and Michael Moore, all the
more power to him. Anyway, Alan Rickman...yup. He's a great actor, no question...
Nicole <off_my_rocker57@hotmail.comfoo>
NO!!!!, NO NO!!!! - Monday, March 24, 2003 at 07:07:45 (PST)
Dee! Pleas read the posts immediately below yours!
Sue
- Monday, March 24, 2003 at 06:56:46 (PST)
Oh, *that* Mike Binder. I didn't really like "The Mind of a Married Man" or "Londinium." Horrendously lucky squirt he is to work with our Man. I went to the site provided to see if a DVD could be procured. No such luck. Also, it's not available at Amazon.com or at Blockbuster. *sob* Anyone have info on how to obtain a copy?
Gissing's Girl--any relation??? And by the way, where is that CdC?
Dee
US - Monday, March 24, 2003 at 06:54:26 (PST)
Oops!!! Try THIS fo JG
Sue
- Monday, March 24, 2003 at 05:37:00 (PST)
As has been mentioned before The Search for John Gissing HAS been aired at quite a
few film festivals in the States and I think in Canada. It has not been released anywhere
and is not available on vid/dvd. I believe it played at the London Film Festival in 2001.
A trailer and lots of pix are available at The
Official Search for John Gissing Page
Sue
England - Monday, March 24, 2003 at 05:34:39 (PST)
Rickfan37!!!!!!!! How did you get to watch *In Search Of John Gissing*? Has it been
only released in the UK and is still in a holding pattern for us Yanks? I saw the trailor
a while back (forget where...) and it looks really funny!
Constance
NC USA - Monday, March 24, 2003 at 05:15:40 (PST)
Rickfan37, have you seen this film. Please tell all and where did you see it? How do
you know so much about it? Jealous.
Gissing's Girl
UK - Monday, March 24, 2003 at 04:39:21 (PST)
Mylê ¿e Alan Rickman jest naj lepszym aktorem wszechczasów .Zakocha³am
siê w nim jakie dwa lata temu . Ja i moja najlepsza przyjació³ka zbieramy
wszystko to co siêz nim wi¹¿e .
agnieszka szczepaniak
£ód, Polska - Monday, March 24, 2003 at 04:18:19 (PST)
Dee, I believe that by referring to a "Binder outing", Georgiana is
referring to one Mike Binder who acted in and, I believe, but I haven't checked, directed
"The Search For John Gissing", a mildly amusing comedy in which our man hams it
up completely, albeit in a moderately attractive way! Check out the desk scene...shades of
our beloved Snape in the way he slides into his seat! And also the scene in the hotel
where he stands at the door, arms folded. All he needed was a cloak and a long black wig
and I would think I'd died and gone to heaven every time I watch it!
Rickfan37
UK - Monday, March 24, 2003 at 03:56:09 (PST)
Sorry I meant to say on that last post that there is new chapters of SiL and TwtBD
up
Gissing's Girl
UK - Monday, March 24, 2003 at 02:50:40 (PST)
Carolyn dear Carolyn did you get my email last week or did I send it to the wrong
address? If you would like to get in touch, my email ad is insley@thewind.fsnet.co.uk and
we can discuss the world in general or AR in particular.
Gissing's Girl
UK - Monday, March 24, 2003 at 02:35:05 (PST)
Yeah, and Nicole "if I see her face on ANOTHER bloody magazine cover I'll scream" Kidman won best actress. But they say it was close - she won by a nose! ;)
Also, I forgot to mention SPC had posted recently too when I listed the Aussies - and
living in the Nation's Capital too - how could I forget you!
Aussiegirl
- Sunday, March 23, 2003 at 23:44:05 (PST)
Really Really Really off topic: Adrian Brody won best actor!!!! And The Pianist won
best screenplay and best director!!!! I love this planet!!!!!
Julia
Calgary, Canada - Sunday, March 23, 2003 at 21:20:20 (PST)
Hi fellow Aussies - I see Janine, Barbara, Carol and Amy (welcome back!) have been active over the last couple of days. I'm posting to let you know that this week's New Idea (cover date March 29) has some great photos of the French and Saunders "Harry Potter" spoof. My stupid scanner is not working so I can't post them (even if I knew how to do that!) There's a great one of Jeremy Irons doing YKW, Nigel Planer (Dumbledore), Alison Steadman (McGonagall), Jennifer Saunders (Ron), Dawn French (HP) and Miranda Richardson (Hermonie). It says Ronnie Corbett is also in it. Bet he was Hagrid. It says it was on BBC recently but no mention of Oz.
Barbara, you said you lobbied Austar and they put on Mesmer especially for you? When was that? Please lobby them again as I'd love to see it. I'll even sign a petition if you want me to! Also, thanks for the info on Quigley (don't get that station - damn!) and Bob Roberts (already taped it).
CdC, if you need any possum skins - I'm your girl. We have many cruising our backyard
every night and I thought they were cute until this morning when I noticed they'd eaten
most of the seedlings I'd spent all day Saturday planting. We found a mother and baby
curled up in our garden shed on Saturday. We knew they loved parsley so we put a cage over
that so they couldn't get it but they've developed a taste for pansies and violas. I
collect possum figurines etc. but if they don't stop eating my plants I might be adding
stuffed ones to my collection!
Aussiegirl
- Sunday, March 23, 2003 at 20:08:42 (PST)
Hi other Gold Coasters! Big W Runaway Bay has Sense and Sensiblility and Galaxy
Quest new on video for $8 AU. I know they are old movies but both necessities in any
serious AR collection.
Carol <djanke@bigpond.net.aufoo>
Gold Coast, Australia - Sunday, March 23, 2003 at 19:51:38 (PST)
Hi Amy welcome back, to the surreal world of this guestbook where everyone is your
friend so cheers. lol. A few years ago my life was so full of incidents I could not figure
out if my life was a good soap opera (are there any?) with a bad scipt or a bad soap opera
with a good script. Remember for your woes that happines is the best revenge. So I
persribe S&S.
Janine
Melb, Vic Australia - Sunday, March 23, 2003 at 19:36:24 (PST)
Hello everyone! Just a reminder to all AUSSIES that next month there are 2 AR
movie's on the PAY! BOB ROBERTS, is on Encore, April, 1, 6, 10, 14, & 27. Also on the
Movie Network, is Quigley down under, April 6, 15 and 24. Looks like the 6th is ok! I have
to agree with Carol from Here!! It is VERY difficult to get any AR movies down here, apart
from the BIG ONE'S..... Just look at Blow Dry - it only came out for rental here, last
month..... took AGES. I was very lucky to get some from the Pay after ringing Austar -
they were great, showing Mesmer, which they played only the one time. Some of his films
NEVER came here.
Barbara the Australian <Hermione_3@hotmail,.comfoo>
Gold Coast, Qld Australia - Sunday, March 23, 2003 at 19:22:28 (PST)
Thank you for the information about "The Search for John Gissing",
Georgiana. I'm sure when it is released I will find out about it here--
Lee <leeearly@aol.comfoo>
Houston, - Sunday, March 23, 2003 at 15:27:51 (PST)
Just to clarify, I did indeed have two store bought CDs of the In Demand music Cds
containing the sought after tangoing Alan Rickman. Amazon mistakenly put them both in the
case instead of including the other CD with only the music. The extra has been claimed by
Julia from Canada and I am awaiting her mailing instructions. It is strange to me since I
waited so long to see it. My computer would not allow me to view it or download.
Unfortunatly, the music on said CD is not my taste but the In Demand video is delicious.
marlana <iammarlana@yahoo.comfoo>
NH USA - Sunday, March 23, 2003 at 14:09:44 (PST)
Off Topics: I can believe it! I've just seen a picture of Judi Dench and realised
I've seen her last sunday at Harvey Nichols. She was going to the ladies toilets on the
fifth floor and I was in to wondering where on earth have I seen her before. Now I recall
that was on the James Bonds latest movies!! And today she is with AR... Ah London is such
a small place...
Nathalie
Paris, but still in London - Sunday, March 23, 2003 at 12:39:04 (PST)
OFF topic: Dame Judi Dench is scheduled to sing "cabaret" at the peace
concert today and she was also scheduled to be a patron at St Andrews charity event along
side with Alan Rickman. So could it be possible to Alan to also appear at the peace
concert ? Hope so for those of us who could have made to the concert.
Nathalie
Paris, - Sunday, March 23, 2003 at 12:23:41 (PST)
Amy the obscure, it's nice to see you back. Hope you're feeling much better
Gissing's Girl
UK - Sunday, March 23, 2003 at 12:18:26 (PST)
"The Search for John Gissing" is an independent film made by the Binder
brothers, Mike, who starred, and Jeff, who produced. They have done lots of other
independent little films, including "Londinium," that I referenced, and also did
a TV show ("The Mind of the Married Man") that aired on HBO, to mixed reviews.
Georgiana
Seattle (partly sunny, meaning mostly raining, and the anti-war march went by my office on
Friday) - Sunday, March 23, 2003 at 11:46:57 (PST)
I feel so ignorant--Georgiana, what is a "Binder outing"? BTW, how is
Seattle? I lived on Bainbridge Island many, many years ago when I was a child, and before
there were many inhabitants there. Very beautiful state that Washington.
Dee
- Sunday, March 23, 2003 at 11:31:43 (PST)
Italics fixed.
Thanks for keeping me on my toes. :-)
Suz (D.o.C.)
Perhaps Suzanne would like to close the italics on stars-planets-clocks' post, which has italicized the remainder of the Guestbook? I start feeling slanted trying to read it ...
"From Sleep and Shadow" and "Busted" were both early TV outings of Rickman's. A 'filmography' including radio, TV, theater, etc., is found on Suzanne's main page.
As to "John Gissing," it has been shown only in film festivals thus far. The
earlier Binder outing, "Londinium," starring a bearded (oh no!) Colin Firth, has
recently been showing on IFC or Sundance (don't recall which), so there is hope we shall
see "Gissing" on cable at some time, if not in video release.
Georgiana
Seattle - Sunday, March 23, 2003 at 11:24:55 (PST)
I'm in desparate need of a new AR fix--I'm back to renting "Robin Hood"--and although I love AR in it, it really is a bad movie. I don't know if I can wait until April 11, 2003 for the HP movie on DVD!! It seems ages away.
I had the funniest weekend--my brother-in-law came to visit, and he could not bear it
when I got on this guestbook!! I would be trying to read the posts or write something, and
he would hover over my shoulder, pull my hair, anything to distract me (mind you, he's
almost 50, and he didn't care when I was doing other things on the computer). I did have a
good visit with him, but it really was hilarious.
Dee
- Sunday, March 23, 2003 at 11:19:50 (PST)
Amy, the lovely obscure: Welcome back! I missed you! So many good posts lately about
Collaterol Damage, movies, close encounters. If you (or anyone else) ever wants to talk
about depression, please don't hesitate to email me. I am at rbrlubber@aol.comfidante I am
living, breathing proof that there is a light at the end of the tunnel. Even the bad times
are good compared to a long time ago. Big hug! Doing any art lately?
Carolyn, dear Carolyn
CO USA - Sunday, March 23, 2003 at 10:03:17 (PST)
Welcome back Amy aka the lovely obscure!..
Cathy
FL US - Sunday, March 23, 2003 at 09:47:16 (PST)
hello all... I dissapeared for a while... depression got pretty bad but I'm back and more obsessed than ever... hope to be in here regularly but we'll see how it pans out hey.
will see you all around. been missing alan and my rickmaniac buddies: IM BACK!
amy aka the lovely obscure <trivialnonsense@hotmail.comfoo>
sydney, australia - Sunday, March 23, 2003 at 04:40:40 (PST)
Dee, I prefer to think that he wears boxers rather than briefs, just like our Snape!
Gissing's Girl
UK - Sunday, March 23, 2003 at 03:01:55 (PST)
To Stars-Planets-Clocks, Thank you so much re the video, I will email you later
tonight. I have been having computer problems but have got my priorities right and am now
able to access this guestbook. I hope the person who was complaining about the offer is
reading as I would like to let them know that I own 9 DVD's and 5 Videos of the Wonderful
Mr. Rickman and every one of them was bought new and all dues paid. I however do also own
some secondhand ones as that is the only way I have had of being able to aquire them. It
is especially hard for us here in Australia as so many movies he is in are not available
for our region. So much so I had to buy an all region DVD player and buy in the DVD's from
overseas. I certainly appreciate the other fans generous offer and applaud her in her
endevours to further the enjoyment we all get from viewing AR.
Carol <djanke@bigpond.net.aufoo>
Gold Coast, Q Australia - Sunday, March 23, 2003 at 00:15:41 (PST)
Hi, As a long time AR fan, I love this site and lurk in here almost every night. You
do a wonderful job. Keep up the good work.. If anyone is trying to locate a copy of
Rasputin they may order it now from Barnes and noble and also Mesmer will be available
there also within 1-2 weeks! I just watched sense and sensibility. He was SO
delightful---cant wait to see it again-wish it were me in that movie--oh Colonel
Brandon!!! Anyway, have a nice one and pleasant AR dreams everyone.. Pam from
Massachusetts
Pam <sholman@tmlp.comfoo>
Norton, MA USA - Saturday, March 22, 2003 at 21:44:04 (PST)
Sue (aka Ali-Pat) sent me a package that arrived today--Galaxy Qwest and it
was a real pleasure to kick back and watch that sucker, again, after a hard day of
exercising my right to free speech! Anybody interested in some very intelligent comments
about politics should definitely check out the off topic site mentioned in the post before
mine. Guess what, I met an AR fan carrying a sign! It was really cool; I got to tell her
about Closet Land and she got to tell me about all her favorite movies. Guess what
THEY were! Then I got to help her rehearse for Fiddler On The Roof (she's Golda) by
singing all of Tevye's part of "Do You Love Me?" We got a few strange looks! lol
I tell ya, it's a small world and it is peopled with lots of AR fans wherever ya go.
Carolyn, dear Carolyn <strangebuttrue@alltimes.comfoo>
CO USA - Saturday, March 22, 2003 at 17:38:08 (PST)
Hi! To anybody interested in a Collateral Damage III report , here it is: Talking Shop.
I know, my links never work. Well, try to cut and paste http://books.dreambook.com/sciclaire/offtopic.html into your browser window... Thanks.
GML
GML
UK - Saturday, March 22, 2003 at 16:16:46 (PST)
I'm sorry. One more thing. What is From Sleep and Shadows. I'm pretty Alan-literate,
and yet, I've never heard of it.
Steph <betterwithph@yahoo.comfoo>
TX USA - Saturday, March 22, 2003 at 16:09:56 (PST)
I apologise for the appaling HTML is my previous post, lol. There should be a break
before 'Ali-Pat' (hope she still sees it!) and much fewer italic words.
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra, ACT Country - Saturday, March 22, 2003 at 16:08:43 (PST)
I'm new here. I can't possibly read all the messages, but as I was scanning, I did
read a few that caught my eye, and then I never saw the answer or conclusion. First, what
was that about a party with Rupert Grint, and second, who had the AR sighting with Rima,
and finally, what movie is it that he speaks of JC as his Savior? Is it Bob Roberts? I've
only seen it once. Anyhow, I'm sure I will enjoy reading the posts.
Stephanie <betterwithph@yahoo.comfoo>
TX USA - Saturday, March 22, 2003 at 16:07:53 (PST)
Eleanor - I cannot speak for everyone, but I do know that when I offered a 'copy' of my Barchester Chronicles tape, meant a real un-pirated copy. I actually own two store-bought copies of the thing. I offered to give this to a fellow fan to prevent it going to waste when I know there are a number of people who find it extremely diffcult to locate things like this. Just for the record, I believe also that you refer to another user who offered a 'copy' of the video CD from 'Texas'. She also miraculously owns two real copies of that, through some sort of mistake at the hands of those she purchased it from.
Ali-Pat - brief is the word! (See Dee's entry somewhere between this and yours for the other
image inspired by your words.) I agree, at least he is a named character, even though he
only has 3 or 4 lines. 'Adore the bag!' is wonderful line. I only had 'Smiley's People' on
rental as I was told the appearance was, well, brief, I never realised just how
brief! Still it was a pleasant distraction.
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra, ACT Country - Saturday, March 22, 2003 at 16:07:13 (PST)
kit if AR mistook me for someone else, who would it be, and what would he say, and what would you say?
He would probably mistake me for a drag Queen dressed up like Snape. Once I was mistaken for Frankenfurter. This happened when I went to see The Rocky Horror Show and some older people queuing for tickets turned to me and asked, "what character was I playing?" I pointed to the transvestites and said, "I am sorry I just happen to look like this and no, I do not compete with the experts as the drag queens look more girly than I do!"
Yet I am sure if he did come up to talk to me I would just gag and sputter and he would
turn to my blushing family and compliment them on looking after there senile/deranged
relative.
Janine
Melb, Vic Australia - Saturday, March 22, 2003 at 12:54:37 (PST)
From Sleep and Shadow Spoilers
I just watched it all again today and absolutely love it. Along with the Preacher it is
one of my favourite AR works. As someone (Ali-Pat?) said, oh to get these on dvd.
There are definite shades of George, Raz and Mesmer in it. Favourite lines - "You can
have my soul" "Keep it, it's too small!"(Pure George!);
" 5 pretty babes....5 different mothers, but that....";
"Do you believe that Christ died and rose again?" "Yes" "If you
can beleive that you can believe anything!"
"You brought back the wrong one" "Ah, yes, well..."
"God Knows" "God knows but do you know?" "NO"
Sue
- Saturday, March 22, 2003 at 09:24:47 (PST)
CdC--I must be in the twilight zone too, because your possum skins, chicken mask
post shows up three times in a row in the GB--what can it all mean???? :)
Dee
- Saturday, March 22, 2003 at 08:55:49 (PST)
I have entered another plane of existence, apparently. I saw Dee's reference to the
'possum skins and somebody else's to the chicken mask but I'm wondering how they knew
about those! References to both were in the part of my post(s) last night that got
excised. In other words, I reread the GB and see NOTHING about these things except what
YOU wrote. Am I transmitting psychically, or what? Also, I'd be willing to carve
"Love the Bag" if someone wants to suggest an illustration to go with it. I
guess Margaret Thatcher's out even if AR would appreciate the humor.
Carolyn, dear Carolyn <Twilight Zonefoo>
CO USA - Saturday, March 22, 2003 at 08:49:28 (PST)
Dee-just briefly reporting the facts! Busted was a TV drama from 1982 in which AR played the part of Simon Jacks. I think Claudia has a clip from it on her site (but I don't have a URL handy to make a link--sorry!).
And now for some book news. In perusing publisher catalogs this morning, I find these two books which might be of interest:
Dark Harbor: Building a House and Home on an Enchanted Island by Ved Mehta (New York: Thunder's Mouth Press, 2003). This autobiographical work takes place very near where the film DKH was set, if not in the exact same place.
A Knight at the Movies: Medieval History on Film by John Aberth (New York:
Routledge, 2003). Features a chapter on RHPOT (and I can't wait to read it!).
Ali-Pat
Dayton, OH USA - Saturday, March 22, 2003 at 08:39:00 (PST)
A DVD can be copied onto a VHS tape as well as being ripped and copied to a VCD or
SVCD.
Claudia
GA US - Saturday, March 22, 2003 at 08:31:23 (PST)
Ali-Pat: I meant to add to the question about "Busted"--you are very
naughty and you know what's going to happen to the posts here if you mention AR in his
briefs . . .
Dee
- Saturday, March 22, 2003 at 08:08:51 (PST)
Ali-Pat: what is "Busted?"
Did we ever hear any comments on "The Search for John Gissing?" A GBer requested some in an earlier post, and I was interested in comments too.
And by the way, good morning everyone.
Dee
- Saturday, March 22, 2003 at 07:59:51 (PST)
ACC--I am not 100% positive of this, but I believe one violates copyright laws when
they profit from the sale of copied media. It is perfectly legal to, say, use your VCR to
copy a movie from the television. However, you could not then turn around and sell it and
earn some spending money for yourself. I do tend to agree with you though that we should
go out and buy our own. As to whether AR's "man-purse would be fattened by our loving
efforts, I heard him say in an interview once that British actors are paid by way of a
"buy out," which, I think, means they get a lump sum and do not collect
residuals. (He is trying to change this.) (Caveat: all of the above is based on much
speculation.)
Dee
- Saturday, March 22, 2003 at 07:56:23 (PST)
Stars-Planets-Clocks: your mention of AR's brief appearance as Brownlow (well, at least he is a named character) reminds me of his most interesting line in that brief appearance. Perhaps Carolyn could carve a stamp with the words, "Adore the bag!". (Did I mention that AR's appearance is brief?)
(Not to be confused with AR's appearance in Busted where he is shown in his briefs and later prepares to present a brief.)
Ali-Pat
Dayton, OH USA - Saturday, March 22, 2003 at 07:47:41 (PST)
Suzanne, WOW! Thank you very much for the "From Sleep and Shadow"
videogram. It is wonderful. I would never have gotten to see this if it weren't for you.
Thank you a million times. He reminds me of a combination of "The Preacher" ,
the Sheriff , Obediah Slope and Rasputin all rolled into one. He is the KING. Perhaps a
declaration of Sainthood sholuld be bestowed upon him and a world wide holiday for his
birthday. He is wonderful. Thank you again, Suzanne!!
Juliana
- Saturday, March 22, 2003 at 07:47:00 (PST)
ACC, I agree with you, but who hear is offering "copies" of DVDs and
videos? Did I miss something? At any rate, I don't think you can copy a DVD. Aren't they
protected?
Eleanor
USA - Saturday, March 22, 2003 at 07:07:26 (PST)
I have an offer for who ever might be interested. I ordered the Texas in Demand
double CD from Amazon, UK and they accidently sent me two of the same discs, the one with
the videos. So now I have one that I don't need. If you would like it I'd be glad to mail
it to you. Just E-Mail me and I'll get your address.
marlana <iammarlana@yahoo.comfoo>
NH USA - Saturday, March 22, 2003 at 05:18:25 (PST)
Anybody else notice Bill Paterson (Eg: Nina's boss Sandy from Truly Madly Deeply) in
Smiley's People playing Strickland? I'm watching it as I type - waiting for the
short-lived glimpse of AR I'm told is to come.
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra, ACT Australia - Saturday, March 22, 2003 at 02:32:07 (PST)
Dee, I don't mind you being the wand polisher- no funny business with the wand
though, we Northamptonians should stick together! CdC ca take care of the baking, you can
polish the wand, and I'll take care of him the rest of the day! Hope that's ageeable to
both of you. Going to be deprived of the Guestbook for the next 5 hours as the internet is
down at College due to a server problem, no fanfiction, no Guestbook, no students, I'll
have to read instead
Gissing's Girl
UK - Saturday, March 22, 2003 at 01:31:21 (PST)
ACC, it's not a pocketbook. It's a MAN-purse! :-)
Christine
USA - Saturday, March 22, 2003 at 01:28:19 (PST)
Barbara the Australian - Yeah, I saw it too. So, I think, did Aussiegirl. If you scroll down there was some discussion about it, March 20 starting at what the site-time calls 9am.
Cheers,
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra, ACT Australia - Friday, March 21, 2003 at 23:06:16 (PST)
Is it legal to copy DVDs and send them through the mail? What about copyrights and
other fees that are bypassed by pirated copies? Could this very public guestbook and
Suzanne have problems because of the practice? Do the companies that own the DVD, video,
audio rights to the material be upset? Are we depriving Mr. Rickman of his fair share? I
don't know the answer to any of these questions, but it might be something to think about
and discuss. Or perhaps certain negotiations could be confined to emails, which are more
private. I would hate to think that having a internet guestbook celebrating Alan Rickman
could increase his popularity whilst depleting his pocketbook. I think it's great that we
share information about the least expensive sources for our "AR fix", but
perhaps we should actually pay for our videos, DVDs, etc....?
A Concerned Citizen
- Friday, March 21, 2003 at 22:57:28 (PST)
All this war talk is very depressing hey? I was watching Dead Ringers the other
night on the ABC and there was this actor taking off AR!!!! Hans from Die Hard, George
from RHPOT, and Snape from HP, and then his Manager( he was Very Angry). He was saying the
SAME line in every movie!!!! I guess we all need a giggle, hey.
Barbara the Australian <Hermione_3@hotmail.comfoo>
Gold Coast, Qld. Australia - Friday, March 21, 2003 at 22:31:47 (PST)
CdC - possum skins! Hahah!
Carol - , Sure, you can have The Barchester Chronicles. Email me with some details and I'll mail it right up. And if you still want to give that other guestbook user (sorry, I've forgotten their name) a copy of Alan singing that french song in ROTN, I have a .wav file and an Mp3 of it.
Cheers,
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra, ACT Australia - Friday, March 21, 2003 at 22:26:19 (PST)
To Stars-Planets-clocks, I would gladly buy the video on offer from you. Please let
me know. To. Nathalie, Thank you for translating the song for me. I shall try and find a
way to get a copy of it onto the internet for you, if you like.
Carol <djanke@bigpond.net.aufoo>
Gold Coast, Qld Australia - Friday, March 21, 2003 at 20:23:44 (PST)
CdC--when will the possum skin and chicken head puzzles be coming out??? Don't you
just hate it when the post-thingie gets weird on you?? :) I take it you don't mind me
being the wand polisher. Cool.
Dee
- Friday, March 21, 2003 at 20:12:59 (PST)
Third attempt to post. It keeps excising the middle of my message! Is that odd, or what! "I saw there was also one entitled 'Rickman in Rubber' "<--Aussiegirl. Made ya look! I knew it would work; this has got to be the capitol of Mind-in-the-Gutterville. I would be happy to carve an image of him all decked out in rubber... leather... 'possum skins ... a gaping raincoat without anything else. Heck, I wouldn't care what he wanted wear. I've even got a really good chicken mask if he was feeling really kinky!
Damn it Janet,
Bjorn Borgitall, Curses Foiled Again!
Carolyn, dear Carolyn
CO US - Friday, March 21, 2003 at 19:49:59 (PST)
Suzanne - you must be some kind of demi-god! Thank you for 'FSAS' and everything else you've posted here for us!
Also, if anybody is badly in need of 'The Barchester Chronicles' on video - my household seems to have wound up with two copies over the years so I'm happy to give one away to whomever.
(I don't know whether or not there's a difference between the type of video cassettes other countries can play or not - guess we'll find out.)
Cheers,
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra, ACT Australia - Friday, March 21, 2003 at 19:06:00 (PST)
Gosh, so many posts, so little time. Dang, those wands are expensive!!!
You know, I have been trying to watch those video clips for days, but every time I start one up, my brother-in-law (who is visiting) gets all weird and starts bothering me so I can't pay attention. What is the dilly-o with that???? It's driving me mad.
GG, speaking of mad, I am mad for Snape, woman!! BTW, I used to live in Northampton, MA, does that qualify me as a sister-city UK resident??? I can't cook very well, but as CdC has offered to bake bread, I can certainly keep the wand polished . . .
Oh! and I guess if AR bumped into me, he would know me as his wand polisher!! Naturally!!
Aussiegirl--I thought the same thing about AR in rubber!!
How did we get on the age thing??? I am sure we are all as beautiful inside as out!!
Dee <IWannaGoToEnglandonaTripfoo>
Pasadena, CA USA - Friday, March 21, 2003 at 19:02:47 (PST)
Thank you, Georgiana. At first I was sure it was and then in certain scenes I lost
the courage of my convictions.
Cindie
- Friday, March 21, 2003 at 17:48:58 (PST)
Hey, nice to see a site that appreciates the always charming Mr. Rickman!! A
question I've been lightly pondering, for those of you who may be in the know: In AABA,
O'Hara calls out "Stella Maris" while making love to young Stella. In TMD, the
actual name of the actress who portrays Maura, the pregnant friend, is Stella Maris. I
would doubt this is a coincidence, but the films' respective directors, screen writers,
etc. are different as far as I can tell. Can anyone provide more info re: this curiosity?
Thanks!!
Virginia, a Rickmaniac
- Friday, March 21, 2003 at 17:05:37 (PST)
Cindie, it's Nigel Hawthorne.
Georgiana
Seattle - Friday, March 21, 2003 at 17:05:37 (PST)
From Sleep and Shadow -- a question and some shallow comments:
Who plays the Pastor? He reminds me of Nigel Hawthorne but then in some shots it doesn't look anything like him.
When Israel of the Ten Tribes no less Yates first bursts through the door my first thought was that Father Guido Sarducci must have ripped this character off.
When Israel is capering in the beginning about "preachin'" and "dancin' naked" his voice reminded me very much of David Friedman in *Judas Kiss*.
Lastly, WOW. If I needed another piece of evidence of our man's talent this was it. What a gem.
Thanks as always to Suzanne and the original provider of this tape for sharing your toys so nicely.
O.K., one more, he does have the Sheriff appeal going here and Obediah Slope would simply cringe over these goings ons.
Cindie
Cleveland, OH - Friday, March 21, 2003 at 16:23:30 (PST)
Oh, now THAT'S weird. Now my "missing post" is up at Claire's Talking Shop
page. Why did it take so long to get there?
Christine (I blame the government)
USA - Friday, March 21, 2003 at 16:05:04 (PST)
Kit, I'd like to be his Library Lady, I could find him all sorts of obscure things
to play on the stage and then discuss the meanings of them with him(maybe). I expect I
would fall to pieces just like I did in New York when I had the chance to say something
and couldn't utter a word.Perhaps what he needs is a good Library Lady at his side!
Gissing's Girl
UK - Friday, March 21, 2003 at 15:31:04 (PST)
Suzanne!!Thank you so much I have just sat here completely *mesmerized*!!!
Sue
- Friday, March 21, 2003 at 15:14:21 (PST)
Could be, Jen. I just finished typing a post there and submitted it, only to find it
was not posted, supposedly because I didn't enter my name. I DID enter my first name, but
maybe "they" want a full name and e-mail address? Plus, that was the second time
I tried to post... the first time I was kicked off AOL in the middle of typing it. The
short version of my post is that I loved your post and "T"s also. I can still
get the Off Topic page, with yours as the last post, though.
Christine (I try to be an intelligible character)
USA - Friday, March 21, 2003 at 15:11:28 (PST)
Carolyn dear Carolyn, I'd love you to come and camp in my house- I'm sure we'd have
lots of fun and we wouldn't fight that much, only over who's going to go first(me) with
the buttons. Poor man would be exhausted by the time the three of us had finished with
him!. I live in Northampton which is about 50 miles from London. I've just watched Dogma
as my friday night film(DH goes out and leaves me to it- very understanding about AR, just
thinks i'm crazy.) I think Metatron is brilliantly played and the accent is wonderful, but
I am currently hooked(really hooked) on Snape but my longtime love is PL O'Hara. Ilove it
when he just stands there for miutes without saying anything, just looking. It doesn't
matter about age because inside where it really matters you feel about 16, especially
around AR. He makes me feel so much better about everything in such a rotten world. I bet
your bread would do that too, I am very fond of home baked bread. Perhaps we could go
clean his windows together, he'd have the cleanest windows in Christendom.
Gissing's Girl <CurrentlyreallyhookedonSnape.foo>
UK - Friday, March 21, 2003 at 15:03:54 (PST)
Jen Off Topic Dreambook is working fine from the UK (grin) - a place where politics and war ARE allowed !
Claire
- Friday, March 21, 2003 at 15:02:40 (PST)
Claire, what has happened to the Off Topic Dreambook? I keep going there to check
for a reply to my post, and now it's mostly unintelligible characters. Government
intervention? LOL
Jen <conspiracytheorist?moi?@yahell.comfoo>
MD, USA - Friday, March 21, 2003 at 14:46:16 (PST)
Hi!everyone, I don't post often, as I'm mostly a lurker, but I just had to respond
to the age thing. I am nearing fifty, am happily married with two grown kids. This
obsession with Alan Rickman is the first of its kind for me. At first I thought there was
something wrong with this but honestly it has done wonders for me and my DH has benefited
as well. Just when I was beginning to feel old I discovered AR and realized that I could
still love "Truly, Madly, Deeply, and Juicily," well into middle age. I love
this guest book and read it almost every day and feel that it is a wonderful indulgence.
marlana <iammarlana@yahoo.comfoo>
NH USA - Friday, March 21, 2003 at 14:32:01 (PST)
Finally got a moment to do one of CdC's on-line puzzles. Think I'm a champion - for the LONGEST time to complete the Snape Puzzle - over 16 minutes and I only did it THAT quickly because my 5 year old son helped me! Anyone got a longer time?
Must also confess that I got a little excited when I saw there was also one entitled
"Rickman in Rubber". Thought CdD had got hold of a PHOTO OF AR IN A FULL LENGTH,
TIGHT, BODY SUIT OF RUBBER! Was greatly disappointed this was not the case (though did
like CdC's carving of AR in a Rubber Stamp). Not quite the same thing though!
Aussiegirl
- Friday, March 21, 2003 at 14:14:23 (PST)
Right click fingers ready...Claire has new pictures and they are all Jamie!
kit
pa usa - Friday, March 21, 2003 at 14:04:41 (PST)
I am surpised no one has yet mentioned the sweepstakes connected with Harry Potter.
Fans vote for the grand prize - current front runner is a walk-on role in the next movie
but other choices include a meeting with a Harry Potter star. It's not clear to me if you
get to choose which star but I think I can guess who everyone on this GB would choose!
Read more about it here.
VH
USA - Friday, March 21, 2003 at 12:27:23 (PST)
Well, Kit, if AR bumped into me in a store, he probably would confuse me with one of
the salespeople. Happens to me all the time. I must look like I know something...
Ali-Pat
Dayton, OH USA - Friday, March 21, 2003 at 12:22:11 (PST)
SUZANNE: Thank you, thank you, thank you for "Sleep and Shadow"! AR as the
Sheriff/Rasputin/Mesmer/Metatron all rolled into one! "I will continue to act"
-- sounds like a good title for his memoirs (which he will never write, but I can dream).
The leap! The fondling! The delectable sibilant "S"! The table dance! Which
reminds me, I know there's a war on and all, but, as the Cure sing, it's Friday -- I'm in
love...
Kate
San Francisco, - Friday, March 21, 2003 at 12:02:56 (PST)
Katie (I think): you asked if I'm New Age. I hate that turm. It looks too much like
it rhymes with "sewage." Things I believe about "religion" do not
easily fit into a certain category. I definitely feel that there is more at work in this
world than readily meets the eye. I work with the wisdom that has been given me...from
VARIOUS sources. That said, if anybody is interested in another wand-selling site
http://www.realmagicwands.com
Like irony? I almost let a free-form loaf of Pizza Caccia Nanza over-brown while I
typed this and the last post!
Carolyn, dear Carolyn
CO USA - Friday, March 21, 2003 at 11:55:40 (PST)
Gissing's Girl said,
"Wouldn't they be surprise to know what goes on in their Library persons' head while
she looks like butter wouldnt melt. You're obviously well read too judging by the quotes!
I like the idea of the triplets, pity we can't meet up- you, me, and Dee AR wouldn't stand
a chance and we wouldn't fight - WOULD WE?"
This is a good opening to bring up something that has been on my mind for a while, ageism.
Think of how many posts you've seen on the GB where people say, "AR sure looks good
for somebody over 50!" My younger friends, this is what over 50 looks like!I'm
guilty of it, too, but more in relation to how I view myself than other people. I think I
look weird. I have grey hair, but I seem to move like someone younger and my clothes
aren't particular to any certain age. I feel like I should act my age and having a
crush on an actor isn't part of that. I also look into the mirror and think, "Oh,
doesn't she look sweet and innocent, absolutely harmless." The part that can't be
seen, though, is just as outrageous as ever -- okay, tempered with wisdom gained through
experience and a little self restraint. So, Gissing's Girl, I think your secret's
safe until you speak with someone else about AR and they catch that wicked little gleam
sparkling in your eye or that pronounced upturn at the corner of your lips! My face is a
dead giveaway--I look like I've been smoking dope! As to not fighting: I can get very
protective about my licorice, but I would do my best. Are you in London? Can Dee and I
camp out on your floor? I bake great bread; I'll bake every day if you want! Laundry?
Window washing? Just name your bribe!
Carolyn, dear Carolyn <nothinsayslovinlikesomethinintheoven@myhouse.comfoo>
CO USA - Friday, March 21, 2003 at 11:45:57 (PST)
Suzanne, what a wonderful picture! Thanks, Ive added it MY personal collection which
is not quite 500, but getting close! Nathalie, what a great experience! I think if he had
come that close to me, he would have spoken something like "Aren't you my cleaning
lady? There was a lot of hair in the bathtub yesterday" and walked on. I would be so
transfixed by the thought of the hair in the bathtub and how it got there, I would just
watch him stroll away! However if he wants me to be his cleaning lady, I'd get my mop out
and clean places that never get cleaned in my house! Question: if AR mistook you for
someone else, who would it be, and what would he say, and what would you say? Don't bother
to keep it clean or moral, I know how all your minds work!
kit
pa usa - Friday, March 21, 2003 at 11:25:25 (PST)
Suzanne, in his intro to The Spirit of Man, Peter Barnes wrote that he wanted it to
be about faith and language, that "only language outlasts the dying it
describes." But language can't come close to expressing how thrilled and grateful I
am for From Sleep and Shadow! It's wonderful--I love Alan Rickman's gleefully exuberant
performance and Peter Barnes' amazing ability to combine ideas, passion, and poetry in his
writing. My favorite parts are when Yates tells Abigail that God doesn't punish us, we do
it to ourselves (and certainly to each other) and that no matter how much we want to
blame, there is no one to blame. It's also interesting to hear some lines very similar to
ones in The Preacher. But they're good sentiments and well worth repeating. So thank you
so so much--you've certainly helped me shake off some of my melancholy soul-dust!
sonoma
usa - Friday, March 21, 2003 at 11:19:27 (PST)
georgiana - the link doesn't work for me - but upcoming wands is just
wonderful.
this is serious!
singing: I'm Don Quixote, the man of La Mancha - Friday, March 21, 2003 at 09:24:33 (PST)
Let's try this link to Alivan's
instead.
Georgiana
Seattle - Friday, March 21, 2003 at 09:14:56 (PST)
Alivan's, Master Wandmakers tells me a wand
resembling Snape's is "on their short list" of upcoming wands.
Georgiana
Seattle - Friday, March 21, 2003 at 09:13:00 (PST)
Dee, funny, come to think of it, the movie'd have two male leads. You just picked
the other one. We just have to decide which one will be Sancho, and which one Quixote.
Then we can take turns in being Jimene (is that right? I don't know where that came from),
a windmill, a horse, a donkey or the Spanish landscape.That's all I remember from the
musical. Was that Peter O'Toole, btw? okay: I'll make that ON TOPIC, now. Don Quixote
would be a wonderful role for AR.ha! Then again, perhaps we would have to share with Anne.
I seem to remember she mentioned Lucious Lucius in Black Hawk Down? Now that is a movie I
WONT be ordering through amazon, even if sorely tempted, because then I would get
recommendations of war movies and that would lead us back to reality which we simply can't
have.
mortianna
and now away, for the weekend, and the next thing I'll post, will be serious and on topic,
I promise - Friday, March 21, 2003 at 08:03:05 (PST)
Just a little ditty from Jason Isaacs on filming HP: Isaacs tells a tale from the
Quidditch shoot. "'Chris came up to this group of extras, and he's saying, 'Get a bit
more involved. Just remember he's been hit by the bludger and he's going for the seeker.'
One of the wizards turned to another and said, 'What the f**k is a seeker and what am I
meant to think about it?' Then Alan Rickman said, 'It depends what house you're in'.'
Ignorance like this, however, is rare. Rowling's books seem to bring about the
trainspotter in everyone. No one seems just content to play a role. They all want to
understand the world, know their characters inside out, become an essential cog in the
fantasy. Isaacs, for instance, insisted upon a decadent look for his sneering Lucius
Malfoy -- cape, fur, silver-topped walking stick and flowing blond hair, rather than the
pin-striped suits the designer originally suggested. 'I said well, he's an aristocrat
Lucius Malfoy, he comes from countless generations of would-be wizards and he's like those
hideous members of the Tory party here who might be in government but really rule the
country behind closed doors and their sofas are tatty and their jackets are tatty but
their grandfather wore them. There's no point in being in a film about wizards and
dressing like a businessman, frankly. Might as well dress like a wizard.' "
Dee
- Friday, March 21, 2003 at 07:22:23 (PST)
Someone earlier this week called the GB an "oasis" in the midst of the world's current turmoil, and I must agree heartliy. If I weren't able to check into this GB a couple of times a day, I think I would be very, very depressed. So thanks, everybody, for being here and having such a good and sometimes thoughtful time.
SOME FROM SLEEP AND SHADOW SPOILERS BELOW
Suzanne, you were seeking opinions on "From Sleep and Shadow"? I agree with
your assessment--I saw a lot of Sheriff and Raz in this portrayal! I wasn't expecting this
to be so funny, having read the script before I ever saw the tape, and I was very
pleasantly surprized by all the zaniness! I mean, right off you know not to take this too
seriously when AR arrives wearing sunglasses! I love all the over-the-topness, including
the table dancing (and what a fluid movement, that leap from floor to table!) and
all the mumbo-jumbo involved in waking the dead. Favorite parts--when the wife describes
hearing the voice of God and AR's character realizes she is talking about HIM (a little
foreshadowing of Dogma here?), and watching that one bead of perspiration roll slowly down
the side of AR's face. Wonder what it would take to get this and other Peter Barnes TV
projects (like Revolutionary Witness) released on DVD...
Ali-Pat
Dayton, OH USA - Friday, March 21, 2003 at 06:53:43 (PST)
Mortianna's life is beginning to remind me of a Harry Potter book--"Mortianna and the Haunting of the Amazon Books." (Of course, we all know who will have the male lead). (Can I be in the movie???)
GG, CdC, okay--we can share . . .
Aaaah, I finally have a free moment to view the videos clips.
Dee
USA - Friday, March 21, 2003 at 06:42:20 (PST)
Thank you, Suzanne, for the wonderful photo! The first time I saw Mr. Rickman in
anything was only 2 and 1/2 months ago. Since then I have been ordering DVDs and videos of
everything available. Can anyone give me information regarding "The Search for John
Gissing"? Thanks--Lee (Great site!)
Lee <leeearly@aol.comfoo>
Houston, - Friday, March 21, 2003 at 05:27:30 (PST)
sorry, this is NEARLY off topic, but I have to tell someone and this is the nearest
place where it oculd fit. I juspt opened amazon again and as a special recommendation for
me they give me the author: Gruber, Hans. I found that quite fascinating. Must be the
stars, or something. as far as I can tell, he writes about stuff I'm not interested in,
but the name...
mortianna
okay, I'm away again, sulking in the dungeon - Friday, March 21, 2003 at 05:26:01 (PST)
Suzanne, thanks a million times for "from sleep and shadow".It is great,
above all the table dance. Here in Germany there is no chance to find somthing like that
on TV and so such Downloads are like christmas and easter on one day for me.It's a great
pleasure to read this GB for you are so witty and charming and you make me laugh. Thanks
Amelie
- Friday, March 21, 2003 at 04:40:26 (PST)
Oops, asketh and you shallst receive. Thanks for the info, Kimberly, it looks like Judi Dench will be travelling up north (she's in London today, at least I hope so!;)
GML
UK - Friday, March 21, 2003 at 03:34:21 (PST)
Nathalie, I thought I'd have a go at translating the song but you beat me to it and I'm sure I can't improve on it! About the Peace Concert, I am not clear when and where and by whom it was suggested that Alan might be there (couldn't find any reference to it on the GB or Talking Shop) but I think it unlikely. We know he supports the cause, all his friends were listed from the start, and he never was. Likely he has to be somewhere else. Scotland would make sense since this is where they are shooting part of Harry Potter III. Anyway, I don't know and am off to London now for Collateral Damage III and the national demonstration tomorrow. Bye!
Nat, félicitations et poursuis la lutte!;)
GML (French, Unreasonable and Unbrainwashable
UK - Friday, March 21, 2003 at 03:26:24 (PST)
Countdown To Charities Campaign Fashion Show 10 Mar 2003
The University of St Andrews Charities Campaign Fashion Show will take place later this month (Sunday 23 March 2003).
It is hoped that the "Don't Walk" event, which will feature a range of haute couture, will raise up to £20,000. An original painting by world renowned Scottish artist Jack Vettriano, Patron of the show, will be auctioned at the glitzy event.
The show, which achieved international acclaim in 2002, will this year support Juvenile Diabetes and Scottish International Relief. Backed by Jack Vettriano, Judi Dench, Alan Rickman and Radio 1's DJ Spoony, the event will again bring the best of European student designs from Paris' ESMOD, Rome's Design Institute and, on exceptional loan, Pierce Brosnan's Die Another Day and Mel Gibson's Braveheart costumes. The show has been heavily sponsored, most notably, by DHL.
NOTE TO EDITORS
You are invited to send a reporter/photographer to the fashion show at St Andrews Bay hotel at 7pm on Sunday 23 March 2003.
Space for photographers will be limited.
To book a press pass, please fax Director Charlie Moretti on 01334 467458.
Passes will be handed out at the entrance to the venue.
ID may be required on the night.
MEDIA WHO HAVE NOT ORDERED A PRESS PASS WILL NOT BE PERMITTED ACCESS TO THE EVENT.
The auction of Jack Vettriano's painting will take place at approximately 7.45pm. A jpeg version of the painting to be auctioned - copyright Jack Vettriano and courtesy of Portland Gallery, London - is available from Claire Grainger, Press Officer, University of St Andrews - 01334 462530 or 07730 415 015.
Kimberly
- Friday, March 21, 2003 at 03:16:54 (PST)
To georgiana: about the sunday events. I remember that Alan Rickman is planned to
appear at a charity campaign at the St Andrews Bay Hotel in Scotland this sunday
afternoon. So how can he be at the peace concert? I think he would have love to
participate but I don't believe he would miss an appointment for another! Maybe if he can
make it he'll be at the concert late in the evening, with some hope!
Nathalie
Paris, which heart still in London... - Friday, March 21, 2003 at 02:49:45 (PST)
Carol,
I've try to translate this beautiful song I'd really love to hear from AR's voice !! Maybe
GML will be more capable than I to do this but let's try :
The Daybreak, to our groves gives all their garments back,
The bird start it soft Love's song again,
Everything celebrate in the Nature the Daybreak,
The Daybreak sometimes causes extreme distress,
The space of night is so short for the shepherd burning with Love,
Forced to leave those he loves at the Daybreak.
Nathalie
Paris, Who has return from a demonstrating in Paris yesterday !!! - Friday, March 21, 2003
at 02:26:30 (PST)
Carolyn dear Carolyn, didn't you know-it's not depravity when applied to AR, it's
called "can't be held responsible as you have very little control over your actions
in the face of such adversity". Just off to work(Library) with the thought of all
those buttons getting between me and the students. Wouldn't they be surprise to know what
goes on in their Library persons' head while she looks like butter wouldnt melt. You're
obviously well read too judging by the quotes! I like the idea of the triplets, pity we
can't meet up- you, me, and Dee AR wouldn't stand a chance and we wouldn't fight - WOULD
WE?
Gissing's Girl
UK - Friday, March 21, 2003 at 01:24:28 (PST)
I forgot to add - the biography has a haunting quality too - it wills me to open it
again and again and have glimpses. So yes, it is bad, but in a fascinating, temperature
rising, way. Did I hear "donkin donuts"?
mortianna again
- Friday, March 21, 2003 at 01:16:53 (PST)
I have to confess the unforgivable sin. My account on amazon kept throwing the
biography at me and in a moment of utter abandon I ordered it. well, what should I say? I
have only had glimpses into it, and from those I can understand the man very well as to
him referring to it as "that awful book". It crams desperate things together and
most annoying of all (until now), insists on calling him the epitome of passive
aggressive. I thought I'd share this gem with you, who have not read it yet. (It is the
revised ed., which comes with "deep" analyses of his roles in HP and GQ and PL).
"In his heart, he's Don Quixote; in his head, he's Sancho Panza."
I mean - wow. The
book seems to be full of stuff like that. Furthermore I ordered Dark Harbor at last. I had
a copy given to me by a wonderful denizen of this realm, but I couldn't understand a word
they were saying - erm, and somehow I got interested enough in the story to be wanting to
know. I had my doubts as to the quality of it, as it says on the cover: Alan Rickman
(Harry Potter, Billy Elliot). But there IS the right DVD in it. And the director's comment
is wonderful. Plus the german subtitles. For anyone not of native american tongue, or hard
of hearing, and interested in the story and not just the naked facts, I would recommend
it. I will surely watch it again - all of it. It has a haunting quality, I think.
mortianna <mortianna02@yahoo.defoo>
- Friday, March 21, 2003 at 01:13:32 (PST)
I was hoping someone would be so kind as to translate the following. Its the song AR
sings in the Return of the Native. Le point dujour, Anos bosquets rend toute leur
parure;L'oiseau reprend doux chant d'amour; Tout celebre dans la nature Lepoint du jour..
Le point du jour Cause parfois, cause douleur extreme; Que l'espace des nuits est court
Pour le berger brulant d'amour, Force de quitter ce qu'il aime Au point du jour.
Carol <djanke@bigpond.net.aufoo>
Gold Coast, Q Australia - Thursday, March 20, 2003 at 23:05:09 (PST)
Sue - Aha, thank you. I wondered what people might have thought of it in the UK. I can kind of see how it would have been a lot funnier on radio, their voices were usually pretty good. (Barring, as you said, AR's) I thought the Parkinson one was pretty funny, and, like you, I enjoyed the Russel Crowe send-up (mainly because he gets on my nerves). I suppose I might have found the rest funnier if had been from the UK and able to recognize everyone they were imitating :). I'd actually like to have a listen to those Radio shows - I'd like to hear that Doctor Who one.
Aussiegirl - It wasn't only me then. I agree, it would have been nice to be familiar with more of their human sources of comedy, I'm sure that would have made it seem a lot funnier. I don't think Rickman ever has been on Parky - though that would be GREAT!! (Aside from the fact that we wouldn't see it down south here for about 6 months after it aired in it's homeland.)
Truth be told though, I'm not sure AR would agree to go on Parkinson. We know he values
his privacy very highly (And good on him for it) and Parky does tend to be quite 'probing'
(braces herself for more wand-puns) in his interviews. It's not really in the same way as
other journalists are, and he's usually exceedingly polite about it - but it does happen
nonetheless. He kind of lulls the guests into it, if you know what I mean. I can see how
it wouldn't be difficult to get someone to feel comfortable talking to you if you were
Michael Parkinson. Because Parky = friendly, sweet and intelligent. You'd think 'He can't
mean me any harm, and he's asked a fair question...' and off you go. Maybe Parky doesn't
even realise he he's doing it, lol. Anyway, as I said above - The Crowe and Parkinson
sketches were very funny, pity the AR one wasn't as well thought through as those two.
Cheers,
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra, ACT Australia - Thursday, March 20, 2003 at 19:44:45 (PST)
All this talk about Snape's wand is getting me hot under the collar! *Furiously fans
self*
Wow, you lovely ladies make me laugh so hard. *Shakes head and sighs* Nathalie, I wish I
could have been at CD!!! If Alan had looked at me the way you said he looked at you, I
would be in the hospital, unable to recover from a euphoric coma. I am in desperate
need of a real Alan fix, due to descriptions of face-to-face meetings.
*Waaaahhhhhh... (sobs uncontrollably)*
~Katie C~
CDC- After catching one of your posts on Snape's wand, I was wondering, are you a
wiccan or a new ager?
Katie C
USA - Thursday, March 20, 2003 at 19:10:20 (PST)
I though of you ladies and had a good chuckle as I was surfing Google for my daughters Harry Potter birthday invitations. I came across a site that sells custom made wands from Harry Potter. Sorry....they didn't carry or make a Snape wand.
Video clips were great!!!!!
THANKS
Tina
Chicago, - Thursday, March 20, 2003 at 18:16:15 (PST)
CdC: I'm with you, but I don't think there would be any sibling rivalry--I think I'd
be the second born, so I would always let the first- and third-borns have their way--uh,
but definitely not with the wand, the willy, the licorice or the musket!! C'mon, let's go
to London!!!
Dee
Pasadena, USA - Thursday, March 20, 2003 at 17:26:21 (PST)
Oh Suzanne! You have been a busy bee! From Sleep and Shadow is a good one. Its one of my favorites...could it be the table dance??? LOL
Thanks Suzanne for your hard work.
Claudia
GA US - Thursday, March 20, 2003 at 17:16:39 (PST)
Thanks Suzanne, for that wonderful picture link. Does anyone know where that was
taken and in what year??It's a great photo of Alan.
Troy08
Lewiston, Me - Thursday, March 20, 2003 at 16:42:23 (PST)
Now I have another treat for you. After the success I had making the Play Videogram, I decided to try an make an even longer Videogram. A little gem some of you may not have seen, called From Sleep and Shadow, from the Spirit of Man series. Unfortunately, it ended up being 40MB, which would probably take a week to download, for those with slower connections! LOL So I decided to see what would happen if I cut it in half, and low-and-behold, both halves put together were about half the size as it was whole!... Okay, now that I've totally confused myself, let me add that, like The Preacher, it's a bit dark when they go into the shadows. And please excuse the low video quality, but my videotape is fuzzy also (and many thanks, BTW, to the person who sent it to me!):
From Sleep and Shadow - Part 1 (FSAS-pt1.exe, 13MB, 11 min, 55 sec)
From Sleep and Shadow - Part 2 (FSAS-pt2.exe, 12MB, 13 min, 5 sec)
The first time I saw it, I thought, "hmmm... a cross between the Sheriff and Rasputin." LOL Would love to hear your reviews of it!
By the way, for the person(s) looking for the Conan O'Brien Videogram (sorry, I can't remember your name), I was having server problems, which is why the links I posted on March 9th didn't work for a few days this week. But it should be working fine now, so please try again.
And a belated thank you to Georgiana, Sue, and everyone else who attended CDII, for
your wonderful reports!
Suzanne <Suz@mail.usa.comfoo>
TX USA - Thursday, March 20, 2003 at 16:10:29 (PST)
Here's that great photo
that was on the cover of the March 6th issue of ea-break Quickie Crosswords Monthly, from
'A Fish Needing Help' (thank you!)
Suzanne <Suz@mail.usa.comfoo>
TX USA - Thursday, March 20, 2003 at 15:58:39 (PST)
Yes SPC, I caught "Dead Ringers" too last night and nearly fell off my
chair when the AR sketch came on as its so rare to see any mention of him in Australian
Media. Your description of the script was very accurate and it was mildly amusing. I
thought the sketches of "our Russ" were much funnier though. And the Michael
Parkinson one was great too (BTW, has Parky ever interviewed AR?). I noted at the end that
the show was produced in 2002 so has probably aired already in the U.K. A couple of the
sketches I just didn't "get" at all because they were about U.K. people I'm not
familiar with. The programme last night was the first in the series - any U.K.ers know how
many we can expect?
Aussiegirl
- Thursday, March 20, 2003 at 15:42:29 (PST)
Gissing's Girl: Think I'd prefer to deal with those nasty old buttons the old fashioned way. Oh, the suspense! And about wand maneuvers, just remember "swish and flick." Practice makes perfect;)
I have a theory: Dee, Gissing's Girl, and Carolyn, dear Carolyn are triplets born to
different mothers in different places at different times because God,in Her infinite
wisdom, knew that we would be just too intense all together in one place. Imagine the
sibling rivalry! Poor poor Rickman. Seriously, I enjoy you two immensely! Wish we DID live
closer together...maybe in London. Nah, we'd probably just dare each other on to new
heights of depravity and get arrested.
Carolyn, dear Carolyn
CO USA - Thursday, March 20, 2003 at 12:05:38 (PST)
Kimberly: Many thanks for the picture of Snape's wand! It provides just enough detail for a description I'll be using in my fanfic at a later date.
CJ: What a wonderful thing your DH does for you! If my DH had a voice like I'd be hounding him constantly to leave me messages. As is, he just looks good and calls me a Snape fembot.
Carolyn, dear Carolyn: I died laughing at your description of searching for Snape's wand. And by the way, I like how you celebrated St. Pat's Day. I'm a huge Chieftains fan and have been lucky enough to see them in concert three times.
On a miscellaneous note, I've come across two sites about AR that you all might find
interesting if you haven't already seen them. The first contains the transcript of the
1999 interview with Conan O'Brien and is located at
http:/members.tripod.com/~DailyTelegiraffe/rickmangalaxyquest.html.It has a great
description of AR's actions during the interview. I loved his story of going through an
earthquake in LA and standing in the doorway of his room with no underwear on. Ooh, la,
la. What images that inspires! The second site is some kind of Hollywood Stock quote where
they measure movie and actor value according to a pseudo stock market evaluation. I found
it interesting that AR is considerably higher than his fellow male actors of Love
Actually. The site is located at http:/movies.hsx.com/servlet/SecurityDetail?symbol=ARICK.
white raven
Houston, TX - Thursday, March 20, 2003 at 11:46:47 (PST)
S-P-C - Dead Ringers is a very funny radio show on BBC Radio 4. It often involves
*celebriities* ringing real people on the phone eg hotel, businesses etc and asking
bizarre questions eg Dr.Who ringing the dry cleaners and asking if they can deliver to
Alpha Centurai and a wicked one of William Hague (former Conservative leader) trying to
get onto Stars In Their Eyes etc etc. The impersonations are usually spot on. HOWEVER, in
their wisdom (or greed) the BBC decided to move it to TV. Of course, people who can do
spot-on voices can't always look like their targets and vice-versa. Some of the tv stuff
was very good eg Russell Crowe, but I am afraid I found the Alan Rickman one neither
sounded or looked like him and the script wasn't particularly funny either. The radio
programmes are available on tape and cds and are well worth a listen.
Sue
England - Thursday, March 20, 2003 at 09:52:40 (PST)
SPC--fabulous!! Thank you. (Very funny description too . . .)
Dee
- Thursday, March 20, 2003 at 09:36:49 (PST)
Kate - excellent theory on the rogue flavourless bean! Of course Costner would have no taste! How did I not see that?
Ham. I like that, :)
Cheers,
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra, ACT Canberra - Thursday, March 20, 2003 at 09:24:11 (PST)
Good grief this page has been rather hormonal recently, I hope were not
synchronising, ladies, the server won't be able to take it! Any Rickman fans in the UK
Tyneside/Northumberland/ Durham area - the Tyneside Cinema in Newcastle is showing Help!
I'm A Fish on Sat 22nd March at 1.30pm and HP and CoS subtitled version on Sat 29th and
Sun 30th March - both at 1.00pm. They are Kids Club screenings, but once I hear That Voice
I'm like a giggling 12 year old anyway!Also there is a rather nice pic on the cover of
Tea-break Quickie Crosswords Monthly (?!!!) 6th March issue. Have e-mailed it to Suzanne -
hope she receives it OK.
A Fish Needing Help
Northumberland, UK - Thursday, March 20, 2003 at 09:11:03 (PST)
Dee: Yes, 700 pics is damn fine thing to have, if highly distracting. I'm using PowerDVD, it works well. Whatever you are using, if it has a 'capture' button, sometimes you just need to change the options for that function so that it does what you want it do. Check through all the options and menus you can find to see of you can fiddle with it's aspects at all.
Some capture functions are set to default capture to a specific folder (usually one well-hidden in the system files of the DVD playing prog.) or to capture to the clipboard, meaning you can only capture once before having to exit and paste your pic somewhere if you want to keep it. Try to get it to capture to a folder you tell it to, then you can watch a whole movie happily clicking away at the capture button, when it's finished go through that folder and keep what you like!
As for the sketch, I've no idea how to get a copy, unless this 'Dead Ringers' show comes out on video or DVD in the Uk sometime soon. But I don't know about that.
I don't remember it exactly, but it mostly went thus:
*********** (Voiceover and picture of false DVD cover) "At last a DVD that fans of Alan Rickman can treasure forever...." (then it went on a bit very sarcastically about the extent of his acting abilites, generally implying that he plays the same 'bad guy' all the time - obviously not done their homework, but anyway...)
Then, cutting in between some fairly shoddy mock-ups of various movie sets, with one of their show's number strutting around as Rickman (the closest resemblance they could get, they seemed to have just had this bloke grow a Hans Gruber-esque beard) - the same voiceover: " Who could forget his wonderful performance in Die Hard?" *Shows their actor, stomping across a set with what looks like a bazooka then turning to the camera to hold up a fist and say* "I'll get you, John McClane!" -
Voiceover: "Or as the evil Sheriff of Nottingham in Robin Hood?" *We see their actor, dressed as our George ;), turn to us on a forest-y set, hold up a fist and say "I'll get you, Robin Hood!".*
"And the truly magnificent turn as the terrifying Professor Snape in Harry Potter?" *Their actor, full Snape kit on, comes down some Hogwart's-esque stairs, and (you guessed it!) holds up a fist and says "I'll get you, Harry Potter!" *
Voiceover: (over several different shots of DVD cover and the following scene which she describes:) "Fans will also be grateful for a DVD special showing what happens when Alan Rickman realises whats going on with his typecasting and attacks his agent..." *Their Rickman storms into an office to confront a suited man on a phone, grabs him by the collar and shouts "I'll get you, Hollywood agent!"
This is followed by more voiceover going on sarcastically about Rickman's acting, before it ends with a final dig at Judi Dench, stating they'll soon be releasing another DVD entitled "Judi Dench Plays Every British Woman Over 40 In Every Movie Ever Made".
***********
The visuals and some lines I remember perfectly, but just in case anyone who saw makes a fuss, a few of the voiceover lines I could only recall the gist of, and had work off half-memories and ad-libs. It was a very quick sketch.
Funny though, as soon as the name Alan Rickman was said, my whole family turned their
eyes to me stimultaneaously, with meaningful half-grins, just to make sure I was watching.
They were thinking "Great, someone apart from us is finally going to pay out that
fellow she likes!" - I could see it in their eyes! But I did laugh, truth be told the
sketch was pretty er, base, and didn't feel like a lot of thought or work had gone into
it, (I'm a BIG fan of sketch comedy, - MPFC!! - and I tend to expect a lot) but was
actually mildly amusing.
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra, ACT Australia - Thursday, March 20, 2003 at 09:03:24 (PST)
Kate just made ham my favorite food.
Dee
- Thursday, March 20, 2003 at 08:46:42 (PST)
Stars-planets-clocks: Ha-ha! LOL at your Bertie Bott's line. But wouldn't the
Costner one would be entirely flavorless? And if this were a special "Robin
Hood" box of Bertie's, I guess the AR one would taste like -- ham ... Thanks to all
who suggested I save tasty AR pics to my hard drive from now on. As Homer Simpson would
say, "D'oh!"
Kate
San Francisco, - Thursday, March 20, 2003 at 08:23:35 (PST)
Thanks Dee and Claudia for the nice compliments about hubby. Sorry no clone ;( but
hey, after 24 years of marriage we need to keep it fresh - but it helps when you marry as
young as we did - as teenagers.
CJ
- Thursday, March 20, 2003 at 08:18:43 (PST)
CJ--yes, nice DH you have there! Sounds like wicked fun. (Does he have a clone somewhere? I've been looking for an AR clone, but no luck yet.)
SPC--help me girl, what program are you using that permits you to capture images from a DVD?? Mine has a little button that says "capture image" but it doesn't seem to work!! Maybe I'm doing something wrong--can you help me?? I need to get 700 pictures tooooooo!! I would also love to see the parody you mention--can anyone assist?
Gissing's Girl: giggle--wandlust.
Dee
Pasadena, CA USA - Thursday, March 20, 2003 at 07:55:56 (PST)
Oh you lucky girl, CJ! Thank you so much for sharing your story. I too get sweet messages from my fella--but I don't think he would ever do what your hubby does--you lucky lucky girl!
And Suzanne....thanks so much for your diligence. It means a lot to those of us that
try to get away from it all by coming here.
Claudia
GA US - Thursday, March 20, 2003 at 07:43:06 (PST)
So glad to see all the other women here that are indulging in their
fantasies about AR
CJ
USA - Thursday, March 20, 2003 at 07:20:28 (PST)
Political... ditty... removed. As I asked before, please keep political posts
off the Guestbook. As others have already suggested (and I thank you), Claire has provided
a very nice forum to express your political views (and many other OT topics): Off Topics Talking Shop
Guestbook.
Suz (D.o.C.)
Anne - Yes, I spotted Issacs in Armageddon too, wandered on my sister watching it
and went 'Hey, a Malfoy!', I got a 'look' in response, but oh well. Againat The War (Who I
can only assume meant to write 'Against The War') - Do you think we could keep the OT
rants to their relegated area, musical or otherwise?
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra, ACT Australia - Thursday, March 20, 2003 at 05:32:26 (PST)
Kate - Well they are EVERY Flavour beans. Ergo, there must be an AR flavoured one in there someplace. (You just want to hope, in your searching, you don't come across the Costner flavoured one first. Ick)
I thought I might have been able to help you with your missing picture, but it seems not. Like another guestbook-er has stated, everytime I see an AR pic online, I save it to my hard drive. I also get a lot of mileage out of the 'capture screenshot' button when I play Rickman's movies, and I have over 700 pictures on my computer. (I never realised it was that many until I checked just now. YIKES! - There must be a hotline for this kind of affliction. If anybody is looking to start a 'gallery' section on an AR website, I'm your kid ;) ).
But anyway, I went right through and I don't have a picture like that one, sorry, good
luck!
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra, ACT Australia - Thursday, March 20, 2003 at 04:16:03 (PST)
Just wondering, did any of the other Australian's see the new sketch show from the
UK 'Dead Ringers' on the ABC just now? About 1/2 an hour ago it aired a sketch poking a
bit of fun at the typecasting of Alan Rickman. I realise this would have aired in the UK
as well - but I don't know when that was. Anyway, did anybody anwhere see it? It was kind
of amusing, once I realised I needn't get too defensive, there's no rule that says A.R. is
exempt from all parody.
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra, ACT Australia - Thursday, March 20, 2003 at 03:20:38 (PST)
CdC are you going to use the "wand" to unbutton, it would be much quicker,
depends on how much of a hurry you are in, or are you going to do it manually? When you
have finished with the wand can I have a go- I need the wand practice
Gissing's Girl
UK - Thursday, March 20, 2003 at 01:24:42 (PST)
Kate email me..I may have the pic your looking for.
Cathy <Snapefan2@aol.comfoo>
FL USA - Wednesday, March 19, 2003 at 23:21:26 (PST)
Cdc, I have officially become a Crumpet Strumpet. Snort!!!
Um, see that ref to phentermine under the friendly "hello"? It's a
weight-loss medication--I know, I know--you all know this stuff already!!
Dee
US - Wednesday, March 19, 2003 at 22:08:54 (PST)
Spam deleted.
Suz (D.o.C.)
Completely off-topic: Speaking of Bruce Willis' Armageddon, did anyone else
who saw it spot Jason Isaacs (Luscious Lucius Malfoy) as a nerdy scientist?
Anne/Manhattan
- Wednesday, March 19, 2003 at 21:38:54 (PST)
Troy08: Would that it were just a bad movie.
Dee: Heck, goat/lamb::Snape/Rickman, call me by the name (wench) for either one and I
will respond. As you may recall, I was first to offer to sign up as a crumpet when AR
listed "crumpet tossing" as his hobby. Do you suppose the man is out there
keeping tabs as to which one of us is most constant and persistent as to her indecent
public offers for his pleasure? I certainly hope so! Anybody who reads this GB will
recognize my unswerving devotion to the cause.
Carolyn, dear Carolyn
CO USA - Wednesday, March 19, 2003 at 19:59:08 (PST)
CdC is a SNAPE WENCH!!! :)
Dee
US - Wednesday, March 19, 2003 at 18:10:54 (PST)
OMG, that's Lynn Thigpen?? Oh bummer!!
Kimberly, Snape's wand is the loveliest thing I've ever seen!
Kate, I hope you find your picture. Every time I see a picture I like of AR on the internet, I save the darn thing to my hard drive. I now have a lovely collection that also acts as my screen saver--pictures of AR always floating across my computer . . . I hope my hard drive never crashes (Knock on wood). . . (BTW, I'm with you on the drinking thing.)
Nathalie, you go girl, but oui, I am a tad jealous and not afraid to admit it--I would
die to have AR do a double-take on me!! Oh to be young, French and bumping into AR!!!
Dee
Pasadena, CA USA - Wednesday, March 19, 2003 at 18:08:01 (PST)
Now why would anyone want to spend their time discussing "Armageddon", a
very bad Bruce Willis movie?
Troy08
Lewiston, Me - Wednesday, March 19, 2003 at 17:15:14 (PST)
Just thought I would try to do a link to the Off Topic site where some of us are
airing our strong convictions about Armageddon Off Topics Dream Book
Carolyn, dear Carolyn
CO USA - Wednesday, March 19, 2003 at 16:59:49 (PST)
Just wondering if there are any Irish AR addicts here. If so, are you near
NewGrange? If so, is it very busy with visitors right now?
Carolyn, dear Carolyn
CO USA - Wednesday, March 19, 2003 at 15:10:14 (PST)
Ummm...Snape's wand. Okay. I'll just straddle his thighs and undo some of these, uh, buttons. And a few, mmmmore, and uh...OH! A photo? You can get into a lot of trouble posting something like that online!
Incidentally, there are new wands at the store where I buy my fat candles, herbs, and um, essentials. They're pretty silly looking, coiled with copper and stones. Clean lines are much nicer.
And how are you celebrating vernal equinox?
Carolyn, dear Carolyn <merrymeet&merrypart&merrymeetagain@alltimes.comfoo>
CO USA - Wednesday, March 19, 2003 at 15:05:50 (PST)
I wish I could oblige the requests to post a photo of Snape's wand, but I do not have the means. Besides, I'm not sure it would translate well from the calendar page to the web since it is a small photo and is printed on newsprint paper. I will say that the photo is to be found on the Day-by-Day calendar (the one where you tear off a page every day, not that I have, however!) and it seems like it cost around 14.95 back in December.
On a sadder note, I see that actress Lynne Thigpen died on March 12 at far too young an
age. She appeared in Bob Roberts as the TV journalist who interviews Bob Roberts
and defiantly stands up for her principles. I have also seen her in other things, but I
will forever remember her from Where In the World is Carmen San Diego?.
Ali-Pat
Dayton, OH USA - Wednesday, March 19, 2003 at 14:36:24 (PST)
All this talk of licorice is making me hungry! At the risk of getting too, ahem,
frivolous, I wonder what an Alan-flavored Bertie Bott's Bean would taste like? IMHO, it
wouldn't exactly be licorice, more like the Joni Mitchell song that Nina and Jamie sing to
each other in TMD: "You taste so bitter and so sweet/ I could drink a case of you,
darling/ And I'd still be on my feet." Well, I guess we could all start drinking
early today, due to depressing world circumstances... Also, I need some help (as if you
couldn't tell). I lost my favorite picture of Alan! I think it was a link posted on the GB
but I;m not sure. I had it bookmarked and now it's a "page moved" message.
Blueish background, he's in black T shirt and jacket, closeup, arms folded, good hair
(sandy with grey), maybe taken about 5 or 6 years ago? Not smiling with his mouth, but
with his eyes. I loved that pic because it had those Jesus eyes that followed you
everywhere. I used to pull it up and look at it when I should have been working, just for
some delicious chastisement. Wah!
Kate
San Francisco, - Wednesday, March 19, 2003 at 13:38:18 (PST)
Here is a photo of "Snape's Wand" from the movie "Harry Potter & The Chamber of Secrets." Snape's Wand
This is not the photo from the calendar. It is a photo that was put out by Warner
Bros., and it was part of a group of photos showing the wands of the various characters.
Kimberly
Michigan - Wednesday, March 19, 2003 at 13:28:35 (PST)
There is a Harry Potter and the Chamber of Secrets desk calendar at Barnes and Noble
on Ebay for $14.99. Does anyone know if this is the right one, ie the one with Snapes'
wand on March 14
Gissing's Girl
UK - Wednesday, March 19, 2003 at 13:01:24 (PST)
I too would like to see Snape's wand! anyone out there oblige?.
Gissing's Girl
UK - Wednesday, March 19, 2003 at 12:46:02 (PST)
Ooooh, Nathalie, sounds like Alan has fallen in love with you at first sight!!!
Lucky you!! I think we may all be jealous, n'est ce pas?
Ooh la lah
Belgium - Wednesday, March 19, 2003 at 12:01:49 (PST)
ADORE ALAN ESPECIALLY IN SENSE & SENSEBILITY
BARBRA RUSSO <tiac99@yahoo.comfoo>
spfld, ma USA - Wednesday, March 19, 2003 at 10:27:21 (PST)
Janine: "We are all in the gutter, but some of us are looking at the
stars." Lady Windermere's Fan Act III
Carolyn, dear Carolyn <somanybookssolittletime@home.comfoo>
CO USA - Wednesday, March 19, 2003 at 08:15:50 (PST)
On the subject of Snapes wand -- Interested parties may wish to read the new
chapter (#16) of The Coiled Splendour of Elrin & Severus Snape of
Slytherin by Superwitch. Note the rating before indulging. I access it from the Fan
Fic page of ensnaringsnape.com and dont know the address of the proper link.
Ali-Pat, I echo White Raven's request -any chance of posting the pic??
Strega
- Wednesday, March 19, 2003 at 07:29:59 (PST)
Re preaching to the converted: I shouldn't presume to speak for everybody else
peace-mongering, BUT I have to say that the reason I keep mailing out peace-themed
postcards is that I feel it is a good thing to turn some positive vibes loose amongst all
the war talk. Kind of like, warkillsuffer *peace* hatedestructionannihilate *peace*
diescorchburn *peace* People need to hear that another option is available. I think actors
(especially someone with a VOICE like Rickman's) and indeed anyone with any
"power", has an obligation to use that power in a positive way. I feel strongly
enough about this that it is the way I raised my children. Sort of a noblesse oblige
mindset. P.S It worked--they are wonderful, responsible people working to make this a
better world.
Carolyn, dear Carolyn <icysnowywindblowyblizzard@myhouse.comfoo>
CO USA - Wednesday, March 19, 2003 at 07:26:24 (PST)
Hello all,
I was wondering if anyone could post a picture of Snape's wand from the HP calendar? I
was hoping to get the calendar for X-mas but no such luck. Since then, it's been a
fruitless search at all the bookstores to find it, especially this late in the new year.
I'd love to see a pic. of that wand! Many thanks.
white raven
Houston, TX - Wednesday, March 19, 2003 at 07:10:36 (PST)
For any french british theatre lovers, I wanted to tell you that Medea (Médée
d'Euripide) is playing in the Chaillot National theatre. The plays is perform by Fiona
Shaw and is play in english (with french translation!). Here is the link to the théâtre de
Chaillot.
Nathalie
Paris, - Wednesday, March 19, 2003 at 07:06:57 (PST)
I was watching my Are You Being Served DVD and saw ads for French and Saunders shows
on DVD. I'm sure this skit will make it onto a DVD eventually, as long as the earlier ones
are selling. Ann
Ann Williams <awilliams@sjc.edufoo>
Simsbury, CT US - Wednesday, March 19, 2003 at 06:57:27 (PST)
Licorice=wand=willy. :)
Dee
Pasadena, CA USA - Wednesday, March 19, 2003 at 06:42:07 (PST)
Hello Rickfan37,
In fact I don't really know, I was already in another world while his was coming my
way. I didn't even noticed it until he was close enough to make me wake of my
"dream" and just turn my back to look in another direction "faking" to
listen to the music. My friend believe so and tell me that it was obvious I was too shy to
talk to him and he must have feel it.
Nathalie
Paris, Oh my shyness will bring me to perdition... - Wednesday, March 19, 2003 at 06:10:06
(PST)
Nathalie, you really believe he was trying to talk to you? That is soooo sweet!
Rickfan37
UK - Wednesday, March 19, 2003 at 05:17:49 (PST)
ALL AUSSIES: Does anyone know if there is any chance of all us southern
hemisphere-ites getting a look-see at this HP Spoof thing? I love French & Saunders
and I'd really like to see what the rest of the actors who have been mentioned as being
involved with it do with their parts. Barbara - Red or black liqorice...now that's
excellent question. I'll have to think on it. This is probably going to involve watching
and rewatching a certain pile of movies, just the kind of dirty work I like. I'll get back
to you! Cheers
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra, ACT Australia - Wednesday, March 19, 2003 at 05:09:29 (PST)
I agree the Collateral Damage events preach to the converted to some extent, but I must say I too have found the one I went to very, very soothing. When you spend all day at work listening to people repeating what they hear on TV without ever pausing to think, it feels wonderful to walk into the NT and feel surrounded by people who are like you. It feels wonderful to be addressed by people who have the huge talent to turn your very feelings into new acts and plays and songs and give their voice to older classics to remind us that it has all happened before and that maybe men would learn to do things better if they read a little more and went to the theatre a little more often.
CDI certainly helped channel some of my anger into something a little more constructive and that is why I will go to CDIII and IV if I can. 3/4 hour of meaningful 'communion' with fellow human beings is worth the trip. (Not to mention meeting the artists!;) - Hopefully there are also quite a few people in the audience who are not already 'converted' but just pop in because it's a freebie event with celebrities, have a good time and go home with a deeper understanding of the situation.
As for the lack of coverage, I have noticed too. The events were mentioned in the Stage, I noticed, but hardly prominently. The march organized for this coming Saturday in London is being very hushed as well in the traditional media this time, unlike the last one. The un-controlled internet seems to be in the process of replacing TV as a medium of mass information. Fascinating.
GML (Liquorice-All-Sorts rules - I sent some to a friend's mum in the US and now she's
hooked on the stuff.)
UK - Wednesday, March 19, 2003 at 04:52:46 (PST)
Dear stars-planets-clocks Or spc as I plan to write as it is shorter if you click
onto the link above Quick Guide to Punctuation and HTML,it is all there yet be carefull I
did have a laugh at the great underlining incident...
Janine
Melb, Vic Australia - Wednesday, March 19, 2003 at 04:32:50 (PST)
Cheers Janine - you have excellent taste, in both actors and candy.
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra (the unburnt third), ACT Australia - Wednesday, March 19, 2003 at 04:29:58 (PST)
Aussiegirl - I'm afraid I won't be able to get 'strip of liqorice' out of my mind,
it's been there for so long - and I also like plain licorice better - but your diagnosis
of liqorice allsort is entirely more accurate. Soft bits, hard bits, dark bits, light
bits, sugary bits, tangy bits - all rolled together to become delicious. This is one of
the silliest and most fun tangents I've ever gone off on. No, I'm not a public servant.
(Although I grant you there are a LOT of them in Canberra, so you weren't really
stereo-typing, you were guessing based on a high likelihood. ;) ) I'm 18 yrs, and I plan
to resist all possibly alleyways that lead to public servant-hood. I thank any gods who
may peruse this board to read it, for that fact that there are other Australians here!
Hello to all of you, it is heartening to discover that you exist! LOL. Can anyone tell me
- how do you make paragraphs happen on this board? All my messages seem to appear in
ungainly 'chunks'. Cheers,
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra (the unburnt third), ACT Australia - Wednesday, March 19, 2003 at 04:24:37 (PST)
OPPs Thank you Canberra it is the most cheerful thing I have heard from our capital
in years.
J9
U know, I carn't spell either - Wednesday, March 19, 2003 at 03:58:28 (PST)
I love liquorice in any form and even like liquorice tea! Thank you Canberra it is the most cheerful thing I have heard our capital in years.
Ah Nathalie, I felt I was with you, thank you for your account and I wish you luck with
your job application. I was emailing to CDC fav. sayings and I find your account related
to a line in an INXS song that I think Oscar Wilde wrote something about "we are all
lying in the gutter and looking at the stars". The internet is such a nice gutter,
and this site is addictive. Yet I think it isn't just the A.R. mania I think we are all
dreamers. sigh..I am glad to "Know you"
Janine who likes to set her teeth in a good liquorice chew (specialy made for diabetics)
Melb, Vic Australia - Wednesday, March 19, 2003 at 03:56:34 (PST)
Dee, I would say this time I've indeed fall tremendously in Love with him, having
observing him lively for quite a moment (or was it at first sike?). He is indeed charming,
very impressive: Perfect. He give the impression to "feel" the people who are
surrounding him. He tries to give a chance to everybody to talk him, giving his time to
listen to them patiently and with interest. I've noticed that his hand were always crossed
while listening to other people. And he did pay attention to everybody include me. I
remember he give a me glance several time while talking to people. When there were no one
left to ask him for an autograph or something he looked at me in the eyes and I didn't
break the eyes contact but didn't move nor speak, fearing to break the charm. I think he
did try to talk to me because he has walking down my way and there was no one else arround
but me and my friend who was turning her back to listen to the concert downstair. She
bawled me for not having talk to him while he has come to me. I'm so crazy!!! But I simply
couln't make it. After he even bump into me. My friend tell me that it was maybe another
way to give me chance to talk to him but the only thing I could do was to give him a
"small" smile that he return into a bright one. Nevertheless, I'm please to know
that he had noticed me and surely will remember my face. I really wish you to live such a
magical moment. Afterward, my head was completly elsewhere and I wasn't able to give my
attention to anything else!!! I'm infuriated with myself for not having make his so subtle
voice sound. And I'm even more infuriated with myself for being in love with someone I
will never reach! Even if loads of men look at me I just don't even pay attention to them
so my mind is focus on Him. I think I'll never be able to accept anybody of a lesser
"mind". Oh no I must be completly nut!!!!! As for my interview it was for an
intership (training period) with a french bank which head office is in London. Ah oui: did
anyone has gone to the première of King Lear? I' really like to go and see it.
Nathalie
Paris, which mind is still in London - Wednesday, March 19, 2003 at 02:44:35 (PST)
Aussie Girl - the Collateral Damage events were, as you said, free and there was no
element of fund-raising of any kind. I think the actors involved just wished to have a
platform to give vent to to their thoughts and feelings on the impending war. Yes, they
were probably preaching to the converted but it is always interesting to have information
and facts given in several ways, both serious and amusing. I have been disappointed to
find no coverage of the events in the press or on TV. As for timing, I would think the
early start (5.15pm) was perhaps governed by the availability of both the actors and the
venue. Many London workers finish at 5pm and would be able to drop in on their way back to
Waterloo Station.
I think that the performers felt, as so many of us do, impotent. You feel you want to make
your voice heard in some way which is why I joined the Big March in February and as Bill
Nighy said it was in some part to make them feel better.
Sue
England - Wednesday, March 19, 2003 at 02:00:23 (PST)
Promise this is the last one from me today but I keep remembering things just after
I hit the "submit" button! re - "licorice allsort" tastier AND
multi-layered - just like AR!
Aussiegirl
- Tuesday, March 18, 2003 at 23:12:08 (PST)
Nathalie, loved your very honest and heart-felt report. You know, every time you mentioned you were going to London for an interview I assumed you were a JOURNALIST and you were interviewing someone! I now realise you were going for a Job Interview! Hope you get the position (can you say what type of job it is?)
And Michaele, good of you to seek other's opinions from around the world and not just
rely and what the media in your country feeds you. Sorry to hear you received an abusive
reply - it was obvious you were opening your mind to other points of view and you should
not be vilified for that.
Aussiegirl
- Tuesday, March 18, 2003 at 23:08:41 (PST)
Hi stars-planets-clocks - welcome to a fellow Aussie! Since joining this interesting group only a few months ago I have noticed about 6 other Aussies contributing - Severina and Janine from Melbourne, Amy in Sydney, Carol and Barbara from The Gold Coast and Gayle from Adelaide. Hope to read your imput too! (Are you a Public Servant? - hope I'm not stereo-typing you!) Also, re - "the strip of licorice" I'd classify AR more as a "licorice allsort" - FAR tastier!
Also, could one of the people who attended CD I or II please answer some questions for me (by the way, thanks for your great reports and photos). What is the main objective of them? Is it to raise funds for the anti-war movement(although I seem to recall they were free to attend)? Is it to influence public opinion (if so, how many people can attend and are they broadcast on TV or radio)? Are they "preaching to the converted" or are they hoping to sway public opinion? Are artists/actors only involved? Why are they on at 5pm (I'd imagine most people would be still at work)?
Aussiegirl
Brisbane , Qld Australia - Tuesday, March 18, 2003 at 23:01:07 (PST)
Alan Rickman a "strip of liquorice"?
*peals of laughter*
Thanks for a delightful image, stars-planets-clocks!
Barbara the Wallpaperer <Red
liquorice or black liquorice? That's the question....foo>
- Tuesday, March 18, 2003 at 21:35:36 (PST)
I wonder too, Michaele! Why doesn't anyone ever talk about the thousands of people
Sodom Hussein has tortured and killed??? And about the genocide he committed on his own
country by draining the marsh-lands where thousands of his people lived and thrived,
turning it into desert, forcing them to flee to other parts of the country to beg for
food, just so he could build more oil wells??! The man is no better than Hitler and must
be stopped! Oh but we're not supposed to talk about that here are we? Sorry. Let us
discuss this further at Claire's off topic page. (hope I did
the link right!)
Sara
New York, USA - Tuesday, March 18, 2003 at 20:42:47 (PST)
Juliana - Glad you like that :) It was one the first things I thought the first time
I noticed him (Oh, I know, I know, everybody has their own little 'how I discovered AR'
story!) when I was about 14, watching Die Hard fpr the first time and thinking of Hans
'Now who is THIS strip of liqorice, hmmm?' I checked the credits for his name and havn't
looked back! Cheers,
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra, ACT Australia - Tuesday, March 18, 2003 at 20:23:04 (PST)
Michaela, you might want to go to Claire's Off Topic page and ask your questions. That AR discussion is a bit more political than this.
Drat, AR has fallen in love with Nathalie!!! C'est la vie!! :)
Veresna Ussep??? Is that a relative of Severus Snape's grandmother, Neurvea Spess? Oh
sorry. . .
Dee
Pasadena, CA USA - Tuesday, March 18, 2003 at 20:10:06 (PST)
hey everyone my name cloe and i beyond worrship alan rickman Im looking for his
address anyone got it. give me an email if you do
cloe watts <fookyourselfalready@yahoo.comfoo>
newyork, ny usa - Tuesday, March 18, 2003 at 17:23:04 (PST)
Stars-Planet-Clocks-- "long strip of liqorice that is Alan Rickman"... on
my God ! what a wonderful vision. You should write for a living. Excellent imagery!!!!!
Juliana
- Tuesday, March 18, 2003 at 17:22:58 (PST)
Gissing's Girl, and CdC here are web address for the following VeresnaUseep's
stories. Enjoy. http://adultfan.nexcess.net/aff/story.php?no=1539 Dont Lie to Me
author VeresnaUseep 14 chapters book 1
http://adultfan.nexcess.net/aff/story.php?no=1540 Secretly Slytherin author
VeresnaUssep 43 chapters book 2 She is going to write a third book, but as yet, I do not
know when. She has another story that she is working on. Love's Labours, Paradise Lost.
When you are on the web page and at her stories if you click on the top section where it
indicates author it takes you to a listing of all her works posted on adultfan.nexcess.
They are very well written in my opinion however, they are very explicit and the new one
has some tough subject matter.
Kim <kimtauchen@hotmail.comfoo>
USA - Tuesday, March 18, 2003 at 17:04:24 (PST)
Just wanted to take a moment to acknowledge that I received three emails from you
all, one of which I scanned but won't take the time to read as it was sent anonymously and
was simply uncalled for as I don't believe I was setting such a negative tone in my
question. I am truely perplexed and honestly want to understand the view point of those
against the war and how they arrived at this viewpoint. At this point, I can't say I have
strong convictions either way about the war except that I know if we can help people being
tortured, then we should. For the other two emails, I will be getting back to you, but it
is time for dinner right now.
Michaele
Chattanooga, TN - Tuesday, March 18, 2003 at 15:06:29 (PST)
Fanfanfan - the Texas In Demand video attached to the Sound page is temporarily off line, I will be changing servers and many pages will move.
I see there is a Texas Paris DVD on ebay saying all region. However I think it should actually read REGION - ALL PAL, not quite the same thing! Caveat Emptor
The new CPP is in fact Truly Madly Deeply.
Claire
- Tuesday, March 18, 2003 at 14:04:35 (PST)
For anyone who wants the link to Verasna Usseps' Fiction it is
http://www.adultfan.nexcess.net/aff/story.php?no=1540 or go to adultfanfiction and type in
her name. Carolyn dear Carolyn glad you have read this particular story and I'm not alone
in enjoying it. I hope that she is not going to leave it there just as it was getting to
the betrothal.Glad someone is on my wavelength and I hope you have worked out your
"redemption".
Gissing's Girl
UK - Tuesday, March 18, 2003 at 13:35:40 (PST)
Nathalie, you got there at *6pm*? Oh, NO!! Ah, well, you got an Alaneyeful (new word) nonetheless, and a smile too (Sigh! Don't worry about being shy, I'm sure he understood. I hope your interview went well, I'd love to live in London for a year or two myself (I'd miss the green fields and the hills too much to live there forever), and I believe I would spend a lot of time at the National Theatre if I did. Good luck.
I believe a number of actors and various artists (and a lot more ordinary people) are sitting outside the House of Commons (Parliament) in London tonight, as I type this. An important vote is taking place a little later on. Wonder if Alan is there. Of course Tony Blair will win (funnily enough, because he can count on all the -pro-war- opposition party votes) and since he is frightened and cowardly enough to have threatened to resign (and turned this into a vote of confidence) if he is not supported, his very unhappy party will have little choice but to support him to save their own careers and the country from chaos. Still, it was good to see all these people outside Parliament on the TV news, and I hope time and history books bring retribution to this government. You know, if this vote goes bad for our beloved Prime Minister, I would hardly be surprised if he became the victim of an attack à-la Bob Roberts, such is the level of my trust in politicians now ;)
GML
UK - Tuesday, March 18, 2003 at 12:47:46 (PST)
Gissing's Girl: Tsk tsk tsk! You've been reading Verasna Ussep's stuff? How decadent! Me too! lol What do they say about great minds? We seem to be on the same wavelengths. BTW if you (or indeed, any of the other GB devotees) would like to get on my mail list just email me at rbrlubber@aol.comfoo. I send out surprises whenever the spirit moves me. Be Warned: I do express my political, religious, sexual opinions therein.
Dee: I'm sorry I forgot to answer when you asked what I meant about puzzles in rubber. Some of the puzzles online were made out of prints I made with my hand carved rubber stamps. Please note that since I don't have a scanner I have to photograph those prints in order to post them on Jigzone. Sometimes I get the orientation wrong when photographing and then the puzzler is puzzled about why his puzzle is sideways. Now you know.
We have eight new windows-- Hurrah! My floors are mud-luscious (because the workman
wasn't careful going in and out) and it's not even Just
spring--Boo! DH, moving the furniture back, is happy as a clam.
Carolyn, dear Carolyn
CO USA - Tuesday, March 18, 2003 at 11:50:59 (PST)
Oh Nathalie, what a shame you missed all the performance! Still sounds like you got
a bit of a *Performance* yourself LOL. Just glad you got to see him anyway. Good luck with
the job, fingers crossed.
Sue
England - Tuesday, March 18, 2003 at 11:44:13 (PST)
Bonjour everybody, I've just come home from my trip to London. Very please to
hearing from you lucky guy who have seen all the CDII! I've missed nearly all the event if
not all. I had an interview just before that had last 2 long hours !!! It seem that the
interview was quite good (cross fingers) but I was so upset to have miss all the event.
I've reached the National Theatre at 6pm and did saw AR. By the time I went upstairs
people were applauding and it was the end of the debat. I saw him right away and he was
all that I saw. My head and heart stopped right away. I couln't move nor speak. I'd just
stood here and observed him until everybody was gone. He was kind and patient with
everyone, giving autographs, taking pictures with anyone who wanted to. There was another
actor (I think) who'd looked at me several time but I couln't recall who it was. Now that
I've read your post I know that his name is Bill Nighy. There was a free violons concert
downstair and I've listen to it while waiting for the fans to go. AR saw me and he even
gaze at me for several second. In fact we gaze at each other for several second but I
could'nt speak nor doing anything else but stay where I was. In fact, I was in another
world and my mind was so focus on him that I didn't notice that he was going on my way and
I suddently feel shocked and ashamed of fixing him so intensely that I feel the urge of
turning my back and faking to listen to the music. So he went back and decided to put his
name on a board among many others. We were next to each other so I've decided to go and
see who else has put his name on this board and ask a guy if it was possible to have a
record of the event. By the time I ask my question Alan was passing so close to me that he
even bump into me. It was THE occasion to talk to him but I couln't so I just looked at
him and smiled and he gave me back the most beautiful smile I've ever seen. I was in Seven
Heaven and unable to say a word. Bill Nighy and someone else reached him and they started
to talked to each other. He was very charming with them but seem to be in a hurry.
Sometimes, he leaned his head to look behind BN where I stood and we looked at each other
for the second time. BN also turned his head to look in my direction. I feel ashamed and
decided I'd better go. I don't know if he was trying to give me a cahnce to talk to him or
if I was only imagining it but I decided not to disturb the man because I thought it
wasn't the right time and the right place. Now I fully regret I haven't say even a word to
him. However, I'm sure that he'll remember me by now. And now my head is full of him from
head to feet, of his wonderfull smile. I'll never forget this so magical and intense
moment. after he has gone I stayed to listen to the lively concert performing by four
violonist. The day after I went to see Dance of Death. The dialog is quite heavy but truly
well performed by Sir Ian McKellen. It was quite a wonderfull and shiny WE that I have
spend in London. I really hope that my interview were successfull. This way I'll able to
go to the theatre every month or even week and maybe bumping into AR once more!! Who
knows?!!LOL
Nathalie
Paris, London air is full of spicies... - Tuesday, March 18, 2003 at 11:24:58 (PST)
Thanks, Georgiana. After I posted, it dawned on me that it might refer to going back
on stage. I had never heard that expression before. Can't wait for him to grace the stage
again.
Claudia
GA US - Tuesday, March 18, 2003 at 10:53:55 (PST)
Hi to all of you. I have been watching the conversation on this GB for some days now
and I thank you for all those links and hints.I would have liked to join your discussion
but I have to improve my vocabulary first, so that I can express what is in my head. I'm
reading Englisch texts all day long, but practising is another thing. For now greetings to
you all Amelie
Amelie <kukuvaja@yahoo.defoo>
GER - Tuesday, March 18, 2003 at 10:40:02 (PST)
Claudia, "tread the boards" = "on the boards" = "on
stage." How do I really feel? He is an interesting, dedicated and very talented
actor. I needed a "fix," and I got it. As for most of you, I wish he worked
more! Or at least that we got to see more of the work he does.
Georgiana (and not the least bit unhappy about where our politics overlap)
Seattle - Tuesday, March 18, 2003 at 10:17:05 (PST)
Carolyn dear Carolyn, Hope you have redeemed yourself sufficiently and the priest
has now given up on you! Try a story by Veresna Ussep on adult fanfiction (once again
about Severus and his exploits) FAIRLY EXPLICIT THOUGH. Will post link later as it's at
home and I'm at work
Gissing's Girl
UK - Tuesday, March 18, 2003 at 09:40:58 (PST)
Michaele! Welcome back! Look for an email from me.
All kidding aside, I do find the photo of Snape's wand fascinating. It is ebony and not
highly decorated--very textured with lots of ridges and subtle shaping. Just the
combination of power and elegance one would associate with its owner.
Ali-Pat <sa.pe@earthlink.netfoo>
Dayton, OH USA - Tuesday, March 18, 2003 at 09:31:39 (PST)
Oh! Claire's got Texas in Demand pics today--and a funny sound clip. None of the
video links took me to videos--or perhaps I did it wrong . . .
FanFanFan
- Tuesday, March 18, 2003 at 08:04:17 (PST)
Thanks to those who emailed me/directed me to links for the Conan O'Brien interview.
Seems neither link is working though - must be me ;) Anyway, jumping back real quick to a
topic that's going to be old news for all of you (but I've only just scrolled down to read
it) - my own personal six degrees to Alan Rickman goes thus: I work with a girl whose
closest friend (who I've met, but only really casually) is Sean Biggerstaff's cousin. The
rest is obvious - Biggerstaff to Rickman through either The Winter Guest or the HP flicks.
And that makes me unusually happy! Anyway, Having only found it a few days ago I feel I
must announce my addiction to this guestbook!!! I had really thought, for years, that I
was the only one with this particular *ahem* -leaning- towards the long strip of liqorice
that is Alan Rickman, and am glad to find I'm not alone anymore! Though I could still
possibly the only Rickmaniac in Canberra - I've yet to meet another RM 'in the flesh'. And
I've never been anywhere even remotely near Rickman himself - which probably explains why
the 'degrees' things is such an absurd little piece of trivial comort to me ;)
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra (the unburnt third), ACT Australia - Tuesday, March 18, 2003 at 07:34:35 (PST)
CdC: from what video/film/anything was the "Texas" puzzle taken? I have
never seen . . .
Dee
- Tuesday, March 18, 2003 at 07:17:23 (PST)
Good morning everyone! I saw this little ditty on Yahoo about marriage and happiness. In a nutshell, it says that marriage does not make people happier. In addition, it states that those who are already happy with themselves prior to marriage tend to stay married longer (and if you are looking for constant euphoria--good luck). This made me ponder why AR has never married the-one-who-cannot-be-named (at least by me). This is something I have wondered about before. Anyone have any insight into this? Don't get me wrong, I don't believe everyone should be married. That's not the issue. Has anyone read an interview with AR where he discusses this?
Michaele: I would have to agree with GML about The Guardian--you can view it online--and with CdC about NPR radio (although I believe all US media with corporate connections is skewed towards the Prez). Try to find some information online regarding Saddam's history--and how he attained power. Don't be afraid to go with your gut feeling as well.
Wish I had a snow day today, and a great big fireplace, and a DH with the initials
AR!!! :)
Dee <Itneversnowshere--Idon'twantmuchdoI?foo>
Pasadena, CA USA - Tuesday, March 18, 2003 at 07:04:52 (PST)
i like alan from the time I saw him plaing The professor Severus Snape, he has
charmed me.
Aneka Dvoøáková <D.Ani@seznam.czfoo>
Pardubice, Czech republic - Tuesday, March 18, 2003 at 06:40:06 (PST)
i like alan from the time I saw him plaing The professor Severus Snape, he has
charmed me.
Aneka Dvoøáková <D..Ani@seznam.czfoo>
Pardubice, Czech republic - Tuesday, March 18, 2003 at 06:39:34 (PST)
Ali-Pat: "Freud's mystic world of meaning needn't have us mystified
It's really very simple what the psyche tries to hide
A thing is a phallic symbol if it's longer than it's wide
And the id goes marching on"
Dee: It was a good dinner even if you couldn't make it to my house. I only visited the Christian Brothers (who live in my kitchen in a bottle) long enough to toast Ireland once. I didn't climb up on the table and sing "Young Ned of the Hill," as sometimes happens. [It occasionally gets loud when I get to the part about hoping Oliver Cromwell is rotting down in hell] AND I didn't make the kids swear allegiance to Eire. All we did was listen to The Pogues, The Chieftains, and watch Michael Collins . Incidentally, AR does cry in this one. Poor De Valera! Poor Michael Collins! Poor Ireland!
Here's a list of all the puzzles I've made so far. Difficulty can be changed by clicking on "Shapes" to the left of the puzzle.
Texas
http://www.jigzone.com/ms/z.php?ui=297688i1845787511&z=51_piece_crazy
Snape Print 1
http://www.jigzone.com/ms/z.php?ui=297688i1845787777&z=50_piece_circles
Bollocks
http://www.jigzone.com/ms/z.php?ui=297688i1845787495&z=50_piece_tri_clip
Rickman in Rubber
http://www.jigzone.com/ms/z.php?ui=297688i1845784463&z=20_piece_classic
Jamie With Cello
http://www.jigzone.com/ms/z.php?ui=297688i1845792987&z=20_piece_classic
Off Topic/Poppy, One of my Birds
http://www.jigzone.com/ms/z.php?ui=297688i494663&z=20_piece_classic
Statement
http://www.jigzone.com/ms/z.php?ui=297688i1845792948&z=44_piece_tri_dove
Michaele: look up your local National Public Radio station and listen to their reports and public interest stories for some different input. Is there a university near you? Many are having speakers from different points of view to debate the issues.
DH is staying home today! We've just begun what the weather man is promising to be a
three day blizzard. Wouldn't you just know this is the day we're getting our
hundred-year-old windows replaced downstairs!
Carolyn, dear Carolyn
CO USA - Tuesday, March 18, 2003 at 06:28:27 (PST)
Hello everyone, I haven't written since August of last year when I gave my report of
seeing Alan at the stage door of PL. I haven't had anything to add, so I just lurk on
occassion. Well, today I have a very important question to ask. I think it is a question
to probably not answer me back on the guestbook,so you can email me at
mmh1990@comcast.net. This question is asked in all seriousness. We are about to go to war
with Iraq. I hear every day about the atrocities Saddam commits on his own people. When I
hear these things, I think, can't we do anything to help these people? Then, I hear the
whole world is against war(who would be for war, no one would). Then I hear someone I
highly admire and respect is also against this. I think we here in America must not be
getting the whole story from our media. The numbers against this are just too great for me
to ignore. I would honestly like someone to explain their opinion to me. I am truly
looking for answers. Everyone else seems so sure of their opinions, and I'm not. I would
appreciate hearing from any of you. Thanks in advance. I will be at work for the rest of
the day and will not have an opportunity to read your responses until later this evening.
Michaele
Chattanooga, TN - Tuesday, March 18, 2003 at 04:33:18 (PST)
Suzanne posted the links to the Conan and The View interviews on March 9. Scroll
down and you should see them. Wonderful interviews!
Claudia
GA US - Tuesday, March 18, 2003 at 03:51:45 (PST)
Although the Guardian has declared itself in favour of war earlier, when people still naively believed that the UN would have a say, it certainly has gone on reporting objectively and has so far made the best case against the war, so I think Guardianistas (and Independentistas) definitely qualify for membership of the new Axis of Evil, Magda, welcome!;). Thanks for the report Georgiana, did anybody go to the anti-slavery event?
GML
UK - Monday, March 17, 2003 at 23:44:28 (PST)
Just wondering if ANYBODY had a video (or a link to one) of Mr. Rickman's Conan
O'Brien interview? I have been searching for about a year, the only link ever found seems
to be permanently down. Thanks if anyone can help!
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra (the unburnt third), ACT Australia - Monday, March 17, 2003 at 23:20:48 (PST)
P.S. I read about blacklisting at the Oscars re George Clooney, Susan Sarandon and
Tim Robbins (our own Bob Roberts)!
Dee <okthat'senoughfortonightfoo>
- Monday, March 17, 2003 at 19:09:53 (PST)
I meant U *Sob* A
Dee
- Monday, March 17, 2003 at 19:06:58 (PST)
Georgiana, for gawd's sake woman, how can you act so calm, cool, and collected??? I am fainting just at the thought of you speaking with AR!!! How do you really feel???
Claudia: you know, I saw a report about the Dixie Chicks, and was totally disheartened by the fact that they made a statement . . . and then apologized. I didn't understand that at all. I believe if you take a stand, then stick by it, even if you lose a couple of sales. I, for one, will never buy any of their albums . . . not that I would have anyway--but it's the ding-dang principle!!
Ali-Pat--dump your therapist and get a Harry Potter calendar. :)
Dee
U *Sob* B - Monday, March 17, 2003 at 19:06:19 (PST)
Wonderful report, Georgiana! Thanks so much for sharing some of your conversation. Question though...and maybe I am just totally out of it but what does "treading the boards" mean?
Also, on the topic of what happens to artists that speak out...did The Dixie Chicks
come up? OMG, what's happening to them is just awful! Reminds me of my WWII and Hollywood
history.
Claudia
GA US - Monday, March 17, 2003 at 18:24:31 (PST)
Carolyn: Thanks for the beautifully carved stamp! Please check your e-mail~
Shizuka Dream <shizukadream@yahoo.comfoo>
- Monday, March 17, 2003 at 18:18:02 (PST)
Yes, as best I can recall when reading it, he did read the whole speech. I thanked him for doing so, commented on how little publicity Byrd's speech had had in the US, that I come to London to hear it. We shook hands. He commisserated and asked how long I was staying. We talked about what happens to US artists and entertainers who speak out against the war, and of blacklisting. I asked about his work and, as usual, know no more now than before. Yes, he is currently working on HP3. Yes, he plans to tread the boards again in the future, but no time soon.
I went from CDII to the returns line and managed to get a ticket to "Loves Labours
Lost" with Joseph Fiennes--grand to hear "When love speaks" done so well. I
also saw "Dance of Death" which, for the third lead, had Owen Teale as the
cousin. Rickman fans know him from "The Search for John Gissing," where I quite
liked him, as compared to this play, where I kept thinking I'd have probably preferred
David Straithairn who did the role in New York. After Mirren's screeching Cleopatra,
though, I was glad to see Frances de la Tour as the Mrs.
Georgiana (and I finished out the trip with Alan Davies in "Auntie and Me," but
the only link to Mr. Rickman I can think of is a shared first name, unless you count being
across the alley from the Albery...)
Seattle - Monday, March 17, 2003 at 17:49:26 (PST)
Lee, sometimes a wand is just a wand (according to my therapist).
Ali-Pat (joking about the therapist, too!)
Dayton, OH USA - Monday, March 17, 2003 at 17:21:00 (PST)
Oh Georgiana, 20 hours for 20 minutes--most definitely a fair trade--can you give more deets on your conversation??? Maria: danke! that was very interesting. I was watching a Spanish-dubbed version of "Robin Hood" the other day, and it just didn't "do" it for me--but then I realized it was only because I don't understand Spanish. (Duh!!)
Virtual St. Patrick's Day dinner at CdC's!!!!!!
Holy Moly! Snape's wand--gotta get me an HP calendar.
Dee
Pasadena, CA USA - Monday, March 17, 2003 at 16:35:25 (PST)
I only just now read the posts here about the anti-slavery event; then I was doing a
web search for a quote from one of my favorite Peter Wimsey novels ("'I can't get
out,' said the starling") and I am feeling a bit stunned by what I read at the link
that search brought me to. Please, if any of you want to, look at it:
http://www.birdnature.com/oct1897/captivity2.html I actually do hope Mr Rickman reads this
GB sometimes as I know no other way to tell him about the link.
Lee
- Monday, March 17, 2003 at 16:18:58 (PST)
So--are we still discussing Snape's wand?
Lee
- Monday, March 17, 2003 at 15:47:35 (PST)
I'm sorry, I don't quite understand; did AR read the entire speech by Robert Byrd?
It looked as if it could have easily been edited to filter the irrelevant bits. Plus, who
chose to read the piece? was it the organisers? AR himself? (I'm up to my old Humanities
game of "spot the bias"!)
Julia
Calgary, Canada - Monday, March 17, 2003 at 15:47:00 (PST)
Dee: concerning to your post from Friday, sorry it took so long! "I was
wondering what people think of AR when they watch a dubbed film...": AR has an effect
on me even without his own voice(I'm German), although he gets in every film another one,
which is sometimes not easy to get used to. The most unfitting synchronisation was done I
think in DH. I heard his real voice the first time when I saw DH on a Danish TV channel
(with subtitles). When I watched it some weeks later in German, I was really shocked, when
I heard his German voice saying his first sentence: "Ladies and gentlemen...".
The voice was much higher than his own and known to me from old children radio plays so it
took me some minutes to get used to it (winded myself on the couch,laughing, and thought,
how could they dare to do this?). ;)
Maria
Germany - Monday, March 17, 2003 at 15:31:31 (PST)
Happy St. Patrick's Day! Taking a break from peeling potatoes and cutting up cabbage
to say
Go mairir an céad, is bliain chun aithrí!
May you live to be one hundred, and a year for repentence!
Carolyn, dear Carolyn <dinnerscookinyou'reinvited@myhouse.comfoo>
CO USA - Monday, March 17, 2003 at 15:18:14 (PST)
I'm sure he was delighted to see you once more, Georgiana. He is very well aware of
your dedication to his many causes.
Ez
UK - Monday, March 17, 2003 at 14:46:49 (PST)
Wow went to read the latest of Gwenn's Redemption and received the message Too many
connections in /var/www/html2/classes/query.php on line 9 site experiencing
overload..please come back in a few minutes. Too popular Gwenn!
Janine
Melb, Vic Australia - Monday, March 17, 2003 at 14:02:53 (PST)
Where are you guys finding all this stuff to download? Someone said there was a les
liasons video online? Is there a site that has this stuff?
lost newbie <um no spam pleasefoo>
- Monday, March 17, 2003 at 13:56:50 (PST)
In view of the discussion surrounding selling homemade copies of dvds,
cds, videos, etc, I was quite surprised to see an AR interview video on ebay
currently bidding at almost $500 US!! Apparently this is an amateur video production
by young drama students/children filmed in September and it lasts less than a half
hour. Someone will profit most handsomely from this sale. What a shame to see ARs
generosity with his time be taken advantage of in this manner. (Tho I must admit,
Id love to have a peek at the video -- naughty girl that I am).
Strega
- Monday, March 17, 2003 at 13:36:10 (PST)
Kids 4 Freedom? Anyone go?
ch <I live in a
vowel state too, yee-haw!foo>
- Monday, March 17, 2003 at 12:50:17 (PST)
Sue - thank you! That's the top section, infuriatingly there doesn't seem to be a
full-length version *anywhere*, but the photo link you posted shows a lot more of him than
anything I've found and is a lovely shot - thanks again, much appreciated. :-) Dee...it
must have been 1993, when I'd just turned 12; they screened 'Truly Madly Deeply' on BBC2
one night, my parents and I stayed up to watch it....never looked back since then! One of
the few films that still provoke the same deep emotional wrenching every time I view it.
(The other, of course, is that great two-tissue-boxes-per-viewing Watership Down!)
Sara
Britain - Monday, March 17, 2003 at 12:16:48 (PST)
So glad you are back safe and sound, Georgiana! Hmmm, tousled hair, huh? Oh myyyyy
that does conjure up some lovely thoughts on a dreary Monday! LOL
Claudia
GA US - Monday, March 17, 2003 at 11:55:26 (PST)
Georgiana, I not exactly certain (I always paid more attention to the Greeks than to the Romans in school), but I think the reference is to Byrd's style of constructing and delivering a speech. One of Cicero's more famous tomes was his treatise on speechifying, called De Oratore.
And although I know that today is actually March 17 (happy St. Paddy's day to all who
celebrate!), my day-by-day Harry Potter calendar is stubbornly stuck on March 14. That day
features a photo of Snape's wand, which I find oddly stimulating...
Ali-Pat
Dayton, still the land of the tragically hick, OH USA - Monday, March 17, 2003 at 11:40:36
(PST)
PS Mr. Byrd is known for quoting Cicero, and someone on the plane to New York told
me there were parallels in his February 12 Senate speech with some classic oratorio or
other. I have not been able to find anything specific on this. Anyone have any ideas or
references? Ali-Pat?
Georgiana
Seattle - Monday, March 17, 2003 at 11:09:41 (PST)
Before his turn at the microphone on Friday, Mr. Rickman was sitting on the floor about four feet in front of me, watching the proceedings from around one of the concrete support slabs in the Lytleton foyer. I spied him when I caught a glimpse of the oxblood loafer from "Voices in Exile," then shifted enough to see that famous tousled hair. Next to him, with concrete at his back and no hope of seeing the 'stage,' was Bill Nighy, who was reviewing his script and muttering to himself.
I had a nice few minutes chat, and a handshake, with Mr. Rickman afterwards about the state of American politics and the public debate. Twenty odd hours in airplanes for twenty-odd minutes? A fair trade, that.
Might I just say in defense of Ruby, who needs none from me I am sure, that in the
first five minutes, David Hare's "Breath of Life" dismissed all of America, the
city of Seattle, and the profession of medicine, and I took it as artistic license
nonetheless. And just think, the term 'vowel states' leaves out the home of Fargo, or
Sioux City (which by virtue of emergency medical care I managed to avoid in a snowstorm
last year) or--where I saw my first "Richard III" with Hume Cronyn and Jessica
Tandy--the Guthrie.
Georgiana (which doesn't mean one should dismiss the twang of a 12-string, or a 'home
companion')
Seattle - Monday, March 17, 2003 at 11:07:51 (PST)
Stars, Planets, Clocks - I would never vilify you!!Castigate maybe!!!! (less
painful!)We all have our own way of doing things. I,personally have no problem with taping
from tv and making copies for people. Also I have copied things that SIMPLY aren't
available here eg ClosetLand, and CME. However when it comes to TROTN and When Love Speaks
etc that ARE available worldwide I would not feel comfortable depriving the Man from his
money!!!Same goes with copying bought dvds vids etc that available in the shops. Just my
opinion though, be interested to hear others.
Sue
England - Monday, March 17, 2003 at 10:17:02 (PST)
Gissing's Girl: I have been looking for a shortcut to redemption since I hit the age
of accountability. The priest said to give up and behave myself. But, thank you anyway!
Carolyn, dear Carolyn <inhalepeace/exhalepeace@yourcenter.comfoofoo>
CO USA - Monday, March 17, 2003 at 10:04:14 (PST)
Carolyn dear Carolyn, if you want a short cut to Redemption, go to the Archives,
January 31, four items down and you will come to Redemption, Elrin and Snape and A Dark
Herbal links. Much easier than typing in all the http stuff. Gissing's Girl.
Gissing's Girl
UK - Monday, March 17, 2003 at 09:53:13 (PST)
I just thought I'd led a friendly, antipodean hand to my fellow rickmaniacs. If
anybody desperately wants copies of ROTN, I have Mp3's of each of the 24 tracks, which I
can either make into 1 CD of Mp3's, or 24 (yikes) seperate CDs of actual CD's you can play
in any old player (each track is 30-40mins long and only 1 will fit on a CD). I am happy
to mail these to people who want them, since I've done the same for 5 or 6 Maniacs I met
online, if they email me and let me know. The RW-CDs cost me about (and this is Australian
$$$ by the way) 80c each, and postage (depending on your location) usually between
$15-$25. So, instead of asking for money I usually do this for a return favour - as there
are just some things (AR-related) that are just impossible to get in Australia. (I think
it usually works out to roughly a total of $20 US) I understand if anyone has off-colour
feelings about the nature of this service, considering no profit goes to Mr. Rickman, the
Thomas Hardy estate, or anyone else involved in ROTN audio project. Originally, I didn't
feel right ripping these Mp3's and the only thing just barely scraped through as some
minor measure of justification for my crime - was that there was just no other way to get
this recording I wanted so much. I was a Thomas Hardy fan well before I became a fan of
Rickman's, and not having a recording of my favourite actor reading my one of my favourite
books bloody well haunted me. So feel free to villify me for this, I understand.
stars-planets-clocks <owl_stretching_time@hotmail.comfoo>
Canberra (The unburnt third), ACT Australia - Monday, March 17, 2003 at 05:49:58 (PST)
I think that if AR ever did grow a soul patch, it would be much cooler and more subtle than that soul plantation Apollo Ohno has on his chin. The best ones I have seen just kind of hang like a cute little fringe off the bottom lip. As for Elliot Marston, I think what he wears is closer to a Van Dyke.
The videos are going out in the mail today, much like Michael Collins's flowers (well,
not exactly). Will everyone please let me know when you receive them and if they play all
right? The giveaway is over for the time being, but if there is a certain video you are
looking for and can't find locally, please let me know and I will look for it at my
incredibly good local used video store. I love to shop!
Ali-Pat (I was only joking about the tractor pull)
Dayton, OH USA - Monday, March 17, 2003 at 05:21:21 (PST)
Sara Britain - I had a rummage around for a cello full length pic without a lot of
success. Is THIS anything
like it?
Sue
England - Monday, March 17, 2003 at 03:59:02 (PST)
sue - thanks a lot for the pics.
mortianna
- Monday, March 17, 2003 at 01:45:41 (PST)
oops
LNSAW <flunkedmathgotanAinEnglishwho'stosayfoo>
- Sunday, March 16, 2003 at 21:09:02 (PST)
Ladies!!!!! Chill!! People are smart in many, many, many different ways!!! Lawsy
me!!
Let's Not Start Another War <Flunkedmathgotanfoo>
Does it really matter? - Sunday, March 16, 2003 at 21:08:07 (PST)
Well said, Elizabeth. Thank you.
Juliana
- Sunday, March 16, 2003 at 20:42:35 (PST)
As a resident of one of the "vowel states" in question, I am just a little
upset that the stereotype Ruby Wax apparently believes about midwesterners has just been
supported by a frequent poster on this guestbook. While I wholeheartedly agree that I know
some people who could be described as "culturally dead," I know just as many
people who are very much culturally and intellectually aware. In my town, there is a great
appreciation for theater, music (from classical to heavy metal and everything in between),
dance, and art. There are also a wide diversity of political views. Though not everyone
here cares to learn about what is going on in the world or wants to study Shakespeare, I
think that the same could be said for most places, including New York, L.A., and even
England. To place any group within the confines of a narrow stereotype is dangerous and
leads only to unwarranted prejudice. To say that Ali-Pat, and by implication my friends
and family, is an exception to a rule of general ignorance is the kind of broad statement
that I would think someone of such a supposedly high intellectual caliber would condemn.
Elizabeth
- Sunday, March 16, 2003 at 20:34:09 (PST)
Um, here's a pic of a "soul patch" (ick). I do hope AR doesn't decide to grow one. But if he did, I'd probably love it, truly, madly, deeply.
http://www.geocities.com/apolo_ohno/pictures.html
Deeeeeeeeee
- Sunday, March 16, 2003 at 19:08:25 (PST)
Sara: just curious as to where you first saw AR lo those many years ago . . .
Herazade: what part of Sacto are you from? (My sis lives in Folsom--er, not in Folsom--you know--the town.)
CdC, what do you mean when you say you do puzzles in rubber???? (And where the heck are they??)
Dang!!! It's almost Monday :(
Dee
Pasadena, USA - Sunday, March 16, 2003 at 19:04:16 (PST)
Shizuka Dream, You didn't get my email? There is something seriously wrong with your server! Thank you so much for the videos! I am very grateful that you took the time to do this and share it with someone you don't know! They are so wonderful! They work just fine, and I am testing the theory that you can't wear out a dvd. You may think it odd, but my favorite part was the "Hard Talk" interview. I am fascinated at how effective AR is at his craft, and it was nice to hear him discuss how he does it. If there is anything you would like to have carved in rubber, just let me know. I would be delighted to repay your kindness.
White Raven: I am embarassed that I didn't notice that second "n." Thank you
for the url.
Carolyn, dear Carolyn <blessedarethepeacemakers@kingdomofheaven.comfoo>
CO USA - Sunday, March 16, 2003 at 17:08:35 (PST)
Re: "Vowel" states, as per Ruby Wax
Ali-Pat really is the exception that proves the rule. I grew up in the Midwest and, sorry to say, 89% of the people there are "culturally dead." The ones who go to tractor pulls are, at least, turning the television off.
The rest of them are still at home, drinking Schlitz and arguing "which chick in Survivor has bigger tits." And, yes, that is a direct quote.
Sorry, Ruby's right. She didn't say it well, but she's mostly right.
Barbara the Wallpaperer <expatriate
midwesternerfoo>
- Sunday, March 16, 2003 at 16:54:51 (PST)
To Carolyn and Kimberly:
Sorry for the lack of post this past week. I've been too busy coaching a badminton team at
a local high school. So far, we've won 2 games and lost 1. I was wondering if you gals
received the VCDs yet. I didn't receive any emails from you, and I started to worry that
the packages didn't make it to you! Did all the CDs work? (THey should have, since I
checked them all before mailing them~)
Take Care~
Shizuka Dream (Su) <shizukadream@yahoo.comfoo>
- Sunday, March 16, 2003 at 16:43:03 (PST)
Ali-Pat - I thought Mr Marston had a soul patch???
Sue
- Sunday, March 16, 2003 at 14:51:31 (PST)
Alright. I'll admit it-I'm clueless(and I don't even live in a vowel state)what is
soul patch???????
Troy08
Lewiston, Me - Sunday, March 16, 2003 at 14:33:04 (PST)
Carolyn, check out Gwenn with two Ns! Here's the link,
http://www.fanfiction.net/read.php?storyid=1117546
Rickfan37
UK - Sunday, March 16, 2003 at 14:30:26 (PST)
Herezade, your post made my day. I look forward to a full, happy life in Rickmania.
By the way, what are the odds of Alan ever growing soul patch? He's had just about every other type of facial hair.
Off to another tractor pull... (one does grow weary of all this high-fallutin'
entertainment in the Vowels of America).
Ali-Pat
Dayton, OH USA - Sunday, March 16, 2003 at 13:50:22 (PST)
I went to the peace rally in my town, there were thousands of people, all polite,
all anxious for peace. I have been lurking here for years, laughing and sighing
alternately about the great AR. There is great wit and passion here, as becomes his
followers. As you can see, my states name is replete with vowels. Do not let slip the dogs
of war! Just as an aside to my fellow members of the AR appreciation society, I am soon to
celebrate my 69 birthday. I mention this for the benefit of those of you who think that
you might grow out of Rickmanitis.
herazade <herazade@webtv.netfoo>
Sacramento, CA USA - Sunday, March 16, 2003 at 13:38:17 (PST)
Sorry, not from USA. British.
Sara
Britain - Sunday, March 16, 2003 at 13:34:54 (PST)
By the way, well done to all who are willing to stand up and be counted on the
anti-war issue. As a socialist and anti-war campaigner for several years now, it is
incredibly heartening to see so many come out against the proposed conflict. Keep it up.
Sara
USA - Sunday, March 16, 2003 at 13:33:56 (PST)
White Raven, thank you for the link to SIL. I'm up to--what is it--chapter 42. I
would like to check out "Redemption," but I can't seem to find one with an
author named Gwen. Please post the link for me. Hang in there with the long work days;
we'll still be here waiting for more TWtBD when you get things back to normal. I couldn't
give up now!
Carolyn, dear Carolyn
CO USA - Sunday, March 16, 2003 at 13:25:25 (PST)
As a new visitor to this site, it is incredibly heartening to find that there are so
many others out there who truly appreciate Alan Rickman. I wish I'd been able to quote you
9 years ago as a much-mocked 12-year-old admirer while everyone else I knew was dribbling
over Take That....all I needed was my tiny Radio Times pic of Alan plus cello happily
blu-tacked over my desk! Qeury: Having tried all this site's (and many others) without
success, does anybody know where I can find the full-length b+w image of Alan as Jamie
playing Bach in the title sequence of 'Truly Madly Deeply', either as a photo or published
on the Web? Thanks :-)
Sara
Britain - Sunday, March 16, 2003 at 13:25:13 (PST)
Just a fast response to some comments since yesterday: Dee, I too love that scene!
It shows why Harry fears Snape so much later in the movie and emphasizes Snape's dislike
of Harry. In fact ALL of those scenes were great and would only have added to the story!
My daughter, a tech theater major, groaned at the egg scene and said "do you know how
long it took the props people to do that effect????" And the Smeltings uniform! LOL
hugely! The Snape scene and the Frennel discovery scene are on the VHS and you don't have
to play games, just wait for them. Ruby Wax: she's dull and boring and rude as well. Glad
she doesn't like the US and lives somewhere else. I think the boy stopped himself in The
Winter Guest (love it) becuase of all the smiling pictures of his dad around looking at
him. After all, he was doing something most parents would not approve of as he skips
school. I was happy with that script decision; it showed that he was maturing and not just
whining (or whingeing)about his life. I'd like to see the stage play, but would miss the
fabulous scenery. Thanks to all CD reports and pitcures. I think celebrities know what
they are there for and it's up to personal feelings of the fan as to what she wants to do.
Polite behavior is always the right choice whether you ask politely or just stay quiet.
kit
pa usa - Sunday, March 16, 2003 at 12:57:19 (PST)
Sue: Kudos and many thanks for providing the pictures and descriptions! I truly envy you. Those were excellent shots you took. One of the things that really stuck with me was the note that AR gave up his seat and sat on the floor. No prima donna here. He seems to be a pretty down-to-earth, always polite individual. I'm certain that can't be said for a great many of his Hollyweird peers.
Dee: Thanks so much for the instructions about the additional scenes. I have the DVD and heard there were additional clips cut from the theatrical version. I was confused when I loaded in Disc 2 at first and didn't see anythign extra. I didn't realize you had to jump through a few hoops to view them. As soon as I get home, I'm commandeering the DVD player. My kids won't mind anyway. My daughter loves HP.
Carolyn,dear Carolyn: If you haven't read Snape in Love yet on ff.net, then you're in
for a real treat! I'd also like to recommend another fic called Redemption by the author
Gwenn. Just as excellent! Both of these authors are very talented and you won't be
disappointed in their work. And many thanks for the lovely comments concerning TwtBD.
white raven
Houston, TX USA - Sunday, March 16, 2003 at 10:47:15 (PST)
Hmm... It would seem as though I've missed quite a lot since the last time I posted.
As to Ruby Wax: I found what she said to be highly offensive. Alas, we all say things at the wrong place at the wrong time, and I'm sure Ms. Wax's comment will not go unchastised. Hmph.
As to Collateral Damage: I wish I could have been there. I would gladly hop on a plane
and go if I could. Even if Alan himself weren't there. I'm trying to get an
anti-war march organized in DC that includes most of the people from my high school. But
that's O/T, so I'll get back on topic.
I don't think that asking someone you appreciate *cough, cough, "AR", cough* for
a photograph at a gathering like CD is too shallow, but I do think that there's a time and
a place for everything, and an anti-war gathering isn't really the place to ask for an
autograph. It all comes down to timing, I suppose. But after all, CD wasn't about Alan
Rickman or Vanessa Redgrave or Bill Nighy or John Sessions. It was about or innate right
to be able to speak our minds.
Now, if you don't mind, I'll run away before someone who is totally opposed to my
opinions tries to hurt me. :o) Love to you all.
Katie C
USA - Sunday, March 16, 2003 at 09:14:59 (PST)
Oh--it did make the news: "Steady rains did not deter thousands from gathering
in downtown Los Angeles, California, where the Rev. Jesse Jackson said the Bush
administration has a "competency crisis." "We are determined as an act of
global consciousness to stop an unnecessary war," Jackson said. "If our nation
pre-emptively invades a nation without consent of the world and then kills and occupies
people, that is a war crime, and we become an outlaw state." (CNN.com)
Dee
USA - Sunday, March 16, 2003 at 09:00:21 (PST)
I have hit the Alan Rickman jack pot here. It's good to see others know what a sexy,
classy man he is. I could listen to him forever.
Nann <girls3intenn@wmconnect.comfoo>
usa - Sunday, March 16, 2003 at 08:55:36 (PST)
Gaaaa! Thank goodness I'm not the only non-juvenile messing around with the kid-disc from HP! :) I guess I could be doing something more worthwhile on the brink of war . . . (I did join the march here in downtown L.A. yesterday--in the pouring rain and freezing weather--very dismal--I don't even think it made the news.)
I love your puzzles, CdC. I've done every one--can I have some more please?
Dee
USA - Sunday, March 16, 2003 at 08:49:59 (PST)
Sue, i really really hate you. So much. I can't believe he sat right in front of
you! GAH! (Love you really ^_^)
Jizel
- Sunday, March 16, 2003 at 08:38:28 (PST)
Dee: Babe, ya know I care! I love those dvd extras. I'm sure somebody somewhere had a very intelligent reason for cutting that Snape scene, but I wish they'd asked us first!
If I do more more puzzles, should I post them here?
Carolyn, dear Carolyn <eachinhalationaprayerforpeaceeachexhalationapr...@mycenter.comfoo>
CO USA - Sunday, March 16, 2003 at 08:11:18 (PST)
GML .....ROFLOL- The new Axis of Evil:)) Can I join you?I'm a Guardianista according
to The Sun.
Magda
Aberdeen, - Sunday, March 16, 2003 at 06:50:38 (PST)
Dee, the deleted Potions class scene is great - Why, oh why on earth did they delete it?! I showed it to my nephews in France over Christmas (they have the DVD in several languages) and they were dead impressed that I had found it (they didn't even know there was something to find). I never told them that I got the secret code on the internet, I like to impress them :D - We played it in French (dubbed) and in English as I was keen to make them listen to Alan's real voice. They decided Snape was way more scary in (Alan's) English, although they preferred Harry's 'French' voice ;)
GML
UK - Sunday, March 16, 2003 at 06:40:38 (PST)
Anne: don't fret too much, when I got to the first spoiler in your post, I stopped reading . . . BUT I am very interested in finishing it after I watch "The Winter Guest."
Does no one care about the secret Snape scene on the HP disc???
Dee
Pasadena, CA USA - Sunday, March 16, 2003 at 06:25:20 (PST)
Ah, I remember reading the Ruby Wax interview at the time. I loved the "vowel states" description ;). You know, what happens is that people join different types of groups in different countries and then compare them on the basis of nationality alone... very unscientific ;). There is no need to feel attacked. Believe this widely-travelled girl, the national percentage of idiots is exactly the same everywhere:
The French managed to protest-vote the racist party of Lepen into second position at the first round of the last presidential election, um, I love my people;). Oh, and I went to my local supermarket yesterday here in England to find that my local, my *local* newspaper (not 'the Sun') had a front page picture of 'Our Boys' prepared to bravely give their lives "While France Dictates to the World" (!!). The article made it clear that these poor guys are going to die because "the French support Saddam!" (Gee, and here I thought that not only France but three quarters of the UN countries were trying to achieve disarmament without a war)- And people were *fighting* to buy the rag. Gasp, my own mild-mannered neighbours! It scared me, and believe me... the English sophistication was nowhere to be seen ;). So I too am glad that Alan chose an American Senator speech. It shows the sort of sensitivity I wish politicians of all sides could get inspiration from.
Anyway, do we get more of these great reports on the CDII event or are people so easily scared that they no longer dare? Have Georgiana and Nathalie been kidnapped? Or did they meet by accident, bomb each other on the spot and now lie dead on the Lyttleton Circle floor?;) Are we getting reports on today's event patron... uh... my English fails me: is it patronized? Sounds wrong. Sounds patronizing. Patron-ned? Sounds worse. OK. Do we get a report on the anti-slavery event *supported* by Alan and Jane Horrocks? Should be uncontroversial enough.
Bye for now, I'm off to enjoy the sunshine (in case anybody wondered why AR had (reported) sunglasses hanging from his shirt collar, it wasn't a fashion-statement, it was protection against the bright sunlight England hasn't seen for a while! It does hurt! ;)
GML
UK resident (born in the new Axis of Evil;) - Sunday, March 16, 2003 at 03:16:02 (PST)
OH NO!! I'm so sorry, I forgot to put SPOILERS AHEAD on my previous post about
Winter Guest. And I was so careful to spell everything right... Moderator, is this
something you can fix? My apologies to anyone who hasn't seen the film yet.
Anne
- Saturday, March 15, 2003 at 21:17:22 (PST)
Does anyone own "HP and the Sorcerer's Stone"? Put disc 2 into your
computer's dvd drive. Get a wand in Diagon Alley, go to the classrooms, click on the pyre,
get past Fluffy, find the key, pick the correct potion, get the stone, and you will be
able to view scenes that were cut out of the movie. There is a lovely extended scene of
Snape in potions class. (Hey it's been raining all day today!) If you have young kids,
they will enjoy it too!!
Dee <It'srainingokay???foo>
Pasadena, CA USA - Saturday, March 15, 2003 at 20:50:00 (PST)
You know, I'm actually sorry I posted those remarks about RW. I would like to be a
better person than that. What I wrote about her mouth was also quite rude. I hope you'll
understand that it was because the things she said were very hurtful and I couldn't resist
proving that she was wrong. My response was not called for. I do know better.
Peace.
Carolyn, dear Carolyn
CO USA - Saturday, March 15, 2003 at 18:17:33 (PST)
Thank you, Kim!
Troy08: Wow! Way to go, Ruby Wax! I haven't heard that kind of blanket insult, made
quite that rudely, since racism was in and one could insult a whole race at once.
"Not wide as a church door, nor deep as a well, but 'twill serve." Why does that
quote remind me of a certain person's mouth?
Carolyn, dear Carolyn
CO USA - Saturday, March 15, 2003 at 16:05:29 (PST)
Carolyn dear Carolyn (hope I got that correct) here is link to Snape in Love (sorry
not link, web address I do not know how to do a link)
http://www.fanfiction.net/read.php?storyid=981820
Kim <kimtauchen@hotmail.comfoo>
USA - Saturday, March 15, 2003 at 15:48:08 (PST)
As I sat down to read the paper this morning with my cup of Earl Grey tea, this aricle made me almost spit the tea out!The article was entitled"What, Exactly, is funny?.It was about the differences in US and British humor.
Quoted in the article was Alans dear friend, Ruby Wax.Miss Wax made some rather disparaging comments about Americans, and NONE were about the "weather".
Ruby wrote in the Guardian"I can't work in the States,once you leave New York and LA, you're in those vowel states-you know-Iowa, Ohio(home to our own Ali-Pat)-and your brain suddenly plummets league below sea level. I tour all around England and even in the more out of the way places, your audience is pretty sop[hiticated. In American vowel land, they are moronic and they make the TV ratings....In this coiunty,children study Shakspeare,thy know what alliteration is and you start off with some basic appriciation of langauge. If your language consists of litle more then guttural grunts and cherry pie, you can't be blamed or not getting it."
Gee Thanks Ruby!!!!I do know what alliteration is and I have studied Shakespeare(thirty years later and I can still recite Frinds, Romans, Countrymen by heart.) I think we shoud take up a collection for Ruby to actully visit the vowel state of Ohio-I think she would be Amazezd!!!!
With comments like those, it is any wonder that Ruby was a flop in America?????
Troy08
Lewiston, Me - Saturday, March 15, 2003 at 14:27:01 (PST)
Sue, thank you posting the pictures. Many of us do not live in the U.K. and have no
access to the papers or to the events at which they were taken. It is nice to read what AR
is doing and catch a new photo of him. Celebrity names draw a lot of attention to causes
and people have a raised awareness when someone they admire participates in a cause they
feel is worthwhile. Thank you for sharing. I am grateful
Juliana
- Saturday, March 15, 2003 at 13:33:30 (PST)
I finally saw The Winter Guest last night. I went to a different Blockbuster than my usual one and there it was, on the shelf. Pretty amazing, as there is next to nothing in those stores more than 5 years old. There are four Blockbusters in our town and they each seem to have a hundred copies of the same 20 just-released films and very little else. I tried to talk them into selling The Winter Guest to me but no luck. The Blockbusters around here weed their collections twice a year so will have to make sure I get to the next sale, as I am certain this video is doomed.
Anyway, I thought the film was wonderful. I know there was a round of discussion less than a month ago, but here are a few more random thoughts.
What a marvelous directorial debut! I wonder why AR has not pursued more directing projects - maybe he just prefers the other side of the camera (he even put himself in this one!)? Despite the lovely scenery and lighting, the choices to me seemed very theatrical, meaning as on a stage. I suppose in large part this had to do with the screenplay itself, with its four "couples" and their dialogue, but the stark landscape seemed almost like a black box theatre to me. There wasn't a lot to do with objects and the kind of close-up cinematic detail that that you tend to get in movies, it was so much more about the characters and the things they say, like a stage play.
The film moved along very smoothly, with the pieces of the four stories all fitting together neatly. The only edit I didn't much care for was the scene where the daughter leaves her mother on the ice and goes and has a frustrated cry - the transition there seemed a little abrupt, like we should have a had a little more warning that that was coming.
I very much liked the choice not to show the boys falling through the frozen sea, to leave the ending more hopeful, as I think the director said in an interview.
The one character I really didn't connect with was the teenaged boy. I'm just not sure where he was coming from, what his motivations were. Does anyone have any thoughts about the young man? Like, what is his story? I suppose I would say that he seems at first like a well-adjusted, helpful, concerned young man, and then we find out that he his father's death is haunting him. I don't know. Why did his father's memory come him at that particular moment? What does he think of this girl - Nita, was that her name? I also thought the foot-washing was a little much, symbollically - but then she was a rather over-the-top young lady, a typical teenaged girl who is at one moment supremely self-assured and the next completely insecure.
This post is getting a little long, but I feel I must also say that if any of you
ladies are considering a serious relationship with a guy named Jamie, make sure the two of
you look into life insurance.;-)
Anne
- Saturday, March 15, 2003 at 12:42:44 (PST)
Sue, you are an absolute angel for taking those photos! Combined with everyone's accounts of CDII, they really helped to make it almost as if I'd been there.
I am probably going to regret posting this, but I'd like to weigh in on the "fan behavior" thing. Four members of my forum went to CDII, and I am REALLY proud of them for doing so. It wasn't just to see AR--I know they also went to show their support for the protest effort. I applaud them for that.
I DO agree that taking photographs if you are not a photographer assigned to the event would fall under "fan behavior," as would asking to shake his hand, or asking for an autograph. I'm pleased to hear that so many of you have your principles and can stick by them no matter how difficult it is (as Sarah did, who mentioned how difficult it was to refrain from asking him to sign the board, because she'd be tempted to ask for a photo). I think that's great. However, I also think it's great that he agreed to be so generous with his "fans." Here I have to agree with "A Shameful Fan" on the use of celebrity to promote this event. (We use celebrities to sell things, why not "use" them to promote thought and debate?)
And I do think that you make a bit of a trade: You trade the increased attention brought to the subject for a few pictures and autographs. Really, in the great scheme of things, I don't think that AR begrudges that time spent if it does indeed, as ASF said, cause people to "spend some time thinking about why he was there in the first place." That's one of the reasons he agreed to perform in the event, instead of merely attending.
By all accounts, AR was gracious as always to those who asked for a moment of his time, and he signed something for one of my dear friends, for whom this was her very first AR encounter. I think that was precious of him, and if it's possible to admire him any more than I already DO, then this event (ALL of it, from what he read to how he behaved) has done so.
I admit that I was waiting all day long yesterday to see if they had gotten the chance to speak to AR. Why? Because I'm a HUGE fan, and so are they, and I knew that speaking to him would be a wonderful experience for them. We discussed it on chat, and were goofier and MORE insane than usual. It was FUN.
Everyone has their own political views, and everyone probably has their own views on "Fan Ettiquette," too. I appreciate what ASF was trying to point out, I just think it could have been expressed differently. It takes a little more time and effort to be KIND in your posts, but it can be done.
As for whether or not looking at the photos if you disagree with the behavior of the
people who've taken them is HYPOCRASY . . . well, let's just call it one of those
"inconsistancies" that we humans are prone to and leave it at that.
Jen
MD USA - Saturday, March 15, 2003 at 12:15:41 (PST)
Oh and thanks Sue for the wonderful pics!
Claudia
GA US - Saturday, March 15, 2003 at 11:25:54 (PST)
Sarah, I wouldn't give to much credence to an anonymous post if I were you.
Claudia
GA US - Saturday, March 15, 2003 at 11:21:19 (PST)
Jenkies, Sarah, I'm not trying to chase anyone away from the GB. I just thought that
there were undoubtedly a few folks that read the GB who dared to ask for an autograph and
a photo of The Man, and they shouldn't be villified for it, you know? They're going to now
feel bad because of some of the comments made here. That's going to be made worse when
those same folks who made the comments click on Sue's picture links . . . It's never nice
to come out with blanket statements, especially not amongst people who are supposed to be
friends. To each his or her own, isn't that right?
ASF
- Saturday, March 15, 2003 at 11:13:29 (PST)
Ooops, the GB has raised it's ugly head, again, thanks to A Shameful Fan. I will bow
out gracefully and scuttle to the safety of Lurkdom. Alas.
Sarah
London, - Saturday, March 15, 2003 at 11:06:17 (PST)
Appears Bill Nighy
went AWOL too.
Sue
- Saturday, March 15, 2003 at 10:51:10 (PST)
SorrrreeeDon't know what happened to the other link then. Trying again
Alan Rickman
Sue
- Saturday, March 15, 2003 at 10:37:48 (PST)
Oh, I'm sorry! I tried to make my sarcasm obvious, but I didn't do a very good job, did I? (I thought the comment about the "lily-whites" would give it away . . . ) Rats!
I totally agree with you, Katy. AR understands what he is doing, as do all celebrities who take part in such things. They know they are "using" (in the best sense of the word!!!) their celebrity status to promote publicity and education on a particular topic, in this case, the impending devastation of war.
He must be aware of the fact that his simply BEING there will draw people to the event who otherwise would not have bothered to show up. I'm sorry if that's an offensive statement, but you know it's true for some people. It's not that they don't support the cause or anything, just that they wouldn't have traveled into London to go unless AR were there. (I'm not saying that anyone who's reported on the event here falls into that category--only the person herself would know, so it's stupid to speculate.)
So if he knows he's using his celebrity to promote the event, then, IMO, he shouldn't mind signing a few items and posting for a few pictures, all in the hope that people will spend some time thinking about why he was there in the first place.
And SUE!!!! I don't find those details "shallow" at all!they are a part of the whole report that you'd expect on an actor's fan site. As for your pictures, A MILLION THANK YOUS! You are a doll! Oh, to have been there! AR and an anti-war demo rolled into one! My kind of Heaven!
Now back to lurkdom . . . Although I'm preparing to giggle at the
"lily-whites" who are undoubtedly going to have to view those piccies!!!
A Shameful Fan
123 Fake Street, Springfield - Saturday, March 15, 2003 at 10:36:11 (PST)
Another couple of pix.
Bill Nighy Apologies for picture
quality but when you join the ranks of the paparazzi you have to take them as you can!!LOL
Sue
- Saturday, March 15, 2003 at 10:35:32 (PST)
OMG Sue: you lucky little devil!!!
Dee
- Saturday, March 15, 2003 at 10:34:30 (PST)
EEEEeeeeeeeeeeee!! Holy Mackerel!!!! Whoa!! I was just messing around with disc 2 of
the "HP and the Sorcerer's Stone" "special widescreen edition" and
there is this whole extra bit with the lovely Professor Snape attached to the potions
class scene!!! (I'm a tad excited.) It's sooooooooo fabulous!!!! Oh, love those pics from
CDII!! Love them, love them, love them!!!
Dee
US - Saturday, March 15, 2003 at 10:32:54 (PST)
Dear Shameful Fan - I love your reverse pychology LOL so here are a couple of pix
from CDII. As they say on the TV "If you don't want to know the result, Look away
from the screen now!!"
AR,John Sessions and Bill
Nighy
Ar and John Sessions
BTW while we are being *shallow* I would just like to point out that when Alan Rickman had
finished his excellent speech he did not return to his chair, as previously reported, but
sat down on the floor immediately in front of my chair (touching feet at one
time!!!LOL)from whence I had a solid 10 mins of close inspection of the back of his
head!!LOL HOWEVER, that is shallow so I shan't report it!!!
Sue
England - Saturday, March 15, 2003 at 10:20:56 (PST)
That was supposed to be sarcastic??? No wonder it's better not to post sarcastic
remarks, because I would have never known from your post! *lol* Seemed to me that you were
TOTALLY against posting the photos, not the other way around. I think people SHOULD post
them. What better way to "spread the word" so to speak (which is one reason why
celebrities participate in events like this. No?) And you know a picture is worth a
thousand words! :)
Katy
CO - Saturday, March 15, 2003 at 10:16:00 (PST)
Oh, dear! I seem to have cut and pasted my post INTO my post! Oh well, you get the
idea! LOL
An Embarassed, Shameful Fan
- Saturday, March 15, 2003 at 10:02:23 (PST)
"Will watch the videos on the news . . .," you and me both! You understood the post perfectly. I was being sarcastic, responding to a previous post which condemned all "fan behavior" (and, as it follows, the people who stooped to anything which falls into that category).
It's lovely to have principles. It's lovely to stick by them. It's NOT lovely to make other people feel bad if they don't share your principles, and making a blanket statement does just that. (Especially when, if someone SHOULD happen to post their photos, those same people would view them. Not cool.)
Now, I really was about to post a link to an amazing photo taken by a FAN at CDII, but I reread my previous post and it convinced me not to! LOL "Will watch the videos on the news . . .," you and me both! You understood the post perfectly. I was being sarcastic, reponding to a post that was made earlier which condemned all "fan behavior" (and, hence, the people who stooped to anything which falls into that category).
It's lovely to have principles. It's lovely to stick by them. It's NOT lovely to make
other people feel bad if they don't share your principles, and making a blanker statement
like that does just that. (Especially when, as I pointed out, if someone SHOULD happen to
post their photos, those same people would view them. Not cool.) Now, I really was about
to post a link to a photo taken by a FAN at CDII, but I reread my previous post and it
convinced me not to! LOL Do I feel guilty for craving it or swooning over it when I
finally saw it? Nope. Not one iota of guilt here. :)
A Shameful Fan
- Saturday, March 15, 2003 at 09:58:37 (PST)
If "fan behavior" is so shameful at such an event, then why have
"stars" be the main attraction? It's a way to draw in those who might otherwise
sit at home, I presume. Photos from any such event should be plastered everywhere so that
others will know that they have compatriots in all countries. Perhaps I misunderstood the
post. If so, forgive me.
Will watch the videos on the news . . .
US - Saturday, March 15, 2003 at 09:50:50 (PST)
BTW, did anyone else notice the signatures on the Collateral Damage hoarding??
Linday Duncan's was there, Bill Nighy's and others. I desperately wanted to ask Alan to
add his. As I get older I've learnt to 'grab the moment' but courage failed me last night
as I knew I'd let myself down and ask for a photo if he did it.....
Sarah
London, USA - Saturday, March 15, 2003 at 09:38:31 (PST)
Better not post any photos you took from CDII, then, as taking AR's photo definitely falls under "fan behavior," which has been judged as terribly, terribly uncouth. Anyone who dared ask for an autograph should feel desperately ashamed, thinking of something so trivial as a signature at a time like this!
So, please, don't post your photos! You don't want to tempt any of the lily-whites into displaying their hypocrasy when they just can't help but view them! Shame, too, since I've seen such lovely ones about, but we MUST abide by our principles!
Repeat after me, you hormone-ridden lot: No lusting at war protests! There, don't you
all feel better now?
A Shameful Fan
- Saturday, March 15, 2003 at 09:32:34 (PST)
Claire. Not you, then?? How tragic!!
Sarah
London, - Saturday, March 15, 2003 at 09:24:01 (PST)
Could someone please post the link to the latest "Snape In Love?"
This would be a good, short choice next time AR demonstrates for peace
http://www.dovecottage.com/Blake/Devine%20Image.html
I've got to get a home page!
Carolyn, dear Carolyn <1stsongoncatstevensgreatesthits@myhousefoo>
CO USA - Saturday, March 15, 2003 at 09:09:10 (PST)
Sarah .... if only, but it was a male ... expect them on ebay Monday (grin)
Claire
- Saturday, March 15, 2003 at 09:08:41 (PST)
Anyone going to CD3?? I work quite close by so will try to sneak in at about 5.30. I
bunked off early to make sure I saw Alan this time but won't do it again, so I'll trog in
late. Yes, Sue, was me you saw. A bit disabled, so a bit wobbly. Are you going to CD3?? I
suppose we GB'ers ought to try to say hello to each other at these events?? BTW, who went
to the film fair at Central Hall in Westminster today and bought ALL the Alan pix bar
one??? I have my suspicions and her name is....! Got my pix developed today. My one of AR
at Dance of Death knocks the Evening Standard one into a cocked hat! A couple of nice ones
from CD2. If I ever get rich I'll buy a scanner!
Sarah
London, - Saturday, March 15, 2003 at 08:54:05 (PST)
Such fabulous reports!! Excellent! Almost as good as being there. Thank you!! A good
percentage of the posters to this GB attended! Can I say I appreciate that you--and not
just AR--made your opinion known and showed your support as well?
Dee
US - Saturday, March 15, 2003 at 08:09:08 (PST)
I'm so sad i missed Collateral Damage. From what i hear from some of your it was
great - he gave up his seat? WHAT AN ANGEL! I did mean to see it but i had two rehearsals
for my drama club last night which finished at six, and it takes ages to get up to London
from where i live. For those of you who were lucky enough to go, i sincerely wish i was
you. ^_^
Jizel
- Saturday, March 15, 2003 at 07:52:45 (PST)
I am exceeding grateful for the speech AR chose to read. Selecting an anti-war
statement BY AN AMERICAN IN POWER makes a point that we (Americans) are NOT united with
the foreign policies expressed by that man living in the White House. Very good choice,
Alan! Hugs to you!
Carolyn, dear Carolyn <another mother for
peace@theunitedstates.comfoo>
CO USA - Saturday, March 15, 2003 at 07:24:41 (PST)
Wow, lots of reports on CD II, and at least one more coming! Maybe two if Nathalie made it. Thank you all, your reports complement each other so well, it feels like being there. (nearly;). By the sound of it, the second event was as good as the first, if not better. Gathering momentum I hope. Told you Bill Nighy was brilliant! (not Nighie as I spelt it in my CDI report, sorry). (In the light of his stand against the war maybe we should re-spell him Bill Nay ;).
And Kimberly, thanks for telling us about the anti-slavery event. What a dilemna. I would love to support that, but am too broke to go to London this Sunday *and* next weekend (I'm hoping to go to CL III and I've already got my ticket for the London Concert for Peace at the Theatre Drury Lane next Sunday) (all profits to Amnesty International and Child charities.) - Not to mention a possible second anti-war march on Saturday. I know, Alan won't be at any of these events, but *I* really want to be there. Difficult choice... Ah, well, since a war is likely to end up in more child slavery (ask the Afghans), I guess I'll treat evil at the roots, miss the anti-slavery event this Sunday (damn, it sounds so good) and support the Peace events next weekend instead. But keep your eyes peeled for more of these, oh you clever human internet browsers: time and money allowing, I'm generally all in favour of combining principles and pleasure (in the handsome shape of our hero).
GML
UK - Saturday, March 15, 2003 at 07:09:32 (PST)
http://www.fanfiction.net/profile.php?userid=295580 Thanks! And yes, they are
Snape-centric!
Witch lisa
- Saturday, March 15, 2003 at 06:07:43 (PST)
Ohhh my!!! Thanks for the morning eye candy, Sue!
Claudia
GA US - Saturday, March 15, 2003 at 05:59:35 (PST)
Here is the Evening
Standard Pic that Sarah mentioned.
BTW Sarah were you the girl with the stick I saw talking to Bill Nighy?
Sue
- Saturday, March 15, 2003 at 05:23:26 (PST)
I went to the Collateral Damage II event at The National Theatre yesterday. It
started with a string quartet playing. They were wonderful but I cant remember their
name ( Maybe someone can help me out?) Corin Redgrave introduced his sister, Vanessa, who
read a very moving Palestinian poem. She then sang Donovans (apparently she marched
with him in the Sixties against Vietnam) *Wear Your Love Like Heaven*. John Sessions then
appeared on stage talking into his mobile as George Bush. He was trying to arrange this
weekends trip to the Azores Who is driving me there? Oh its surrounded
by water you say? Etc. etc. He was constantly interrupted by aides, advisors etc and
then Tony Blair rang him. Anybody who knows John Sessions work will know how good he is at
voices and it was very funny. Alan Rickman was then introduced and he read the American
senators speech (see below for link). It says a lot for the Senators speech
that I could take it all in as well admire ARs wonderful presentation of it. He was
followed by Bill Nighy who did a very funny but bitter tale of a *friend* who was going to
go down to *Abduls* (real name Adam) corner shop and torch the place with all his family
in it. The event was over all too quickly and I too didnt feel it was an *autograph*
occasion but took some photos as people milled about at the end. Bill Nighy was a very
nice guy and I had quite a chat with him. We spoke of the impotence so many feel about the
impending war. I said that I didnt suppose the March or CD would make much
difference though and he agreed but said It makes US feel better I did manage
to thank Alan Rickman for doing the event to which he replied Youre
Welcome (I think!! LOL) A wonderful and thought-provoking event.
Sue
England - Saturday, March 15, 2003 at 04:58:05 (PST)
Oh and Sarah...thanks so much for your desciption of his "look" at the
event....was quite nice to wake up to! LOL
Claudia
GA US - Saturday, March 15, 2003 at 04:38:31 (PST)
Sarah, Lucida, and Eric. You did wonderful jobs in reporting CDamage II! Thank you so very much! And yes Sarah and Lucida, you are absolutely right....this type of event is most assuredly not a time to be asking for autographs or displaying fan behavior.
Now, can't wait for Georgiana's review!
Claudia
GA US - Saturday, March 15, 2003 at 04:37:31 (PST)
Thanks Sarah, I was there too (Collateral Damage II) and I think you caught the mood beautifully. I never noticed Alan sitting at a table, he was already kneeling (or rather standing on his knees) on the floor when I saw him, and he was practically lying on the floor on his side when I saw him again later on. What can I add to your report? I went to the last Collateral Damage evening and I think it was a little more crowded this time, and the crowd itself was more varied. There were quite a few people who seemed to have come straight from work and thought this would be a good thing to attend before going back home to their everyday life. Vanessa Regrave said that the song she sang (accompanied by gentle violin music) was written at the time she was marching against the Vietnam war. The poem she read was Palestinian. Bill Nighy was as funny this time as he was serious last time. I hope he appears in the CL evenings to come. The piece (Ron) he acted sounded very familiar. Either I have read it somewhere, or more likely, I have read something extremely similar (quite a while ago) (rewriting current international relationships by substituting familiar individuals for whole countries is a great device and it does bring things home to people). The serious politician speech came from Alan this time. He was introduced as the Great Alan Rickman. Big cheer. You already know what he read/acted. He found a chair to sit on after his piece. The dialogue acted at the end was very funny too (I wish I had taken notes): ennemies being defined as friends of ennemies, ennemies of friends, friends as ennemies of friends, or ennemies of other ennemies, you get the drift, I am not doing it justice. Oh, and Sarah, I notice that you have omitted the poem written by Harold Pinter and read by Colin Redgrave¡ I don't want to get it wrong so I will quote the only bit I remember faithfully : ¡°F*ck!¡± ¡°The big pr*cks are out¡±. It was as short and brutal as the war we are about to witness. I didn¡¯t try to speak to Alan either at the end. I know the way to attract people to such events is to convince big names like him to attend and any subsequent attention from fan who only came to see him is politely received as part of the package, but I personally felt that fan-behaviour would be out of place in this case. This was not about Alan, this was about what is being thrown at the world by the White House and blamed on European "real" friends.
I don't know if this post is considered appropriate for this place so I will post it on
Claire's "Talking Shop" page too (accessible from her main page, I don't know
how to do a link, sorry) where the rest of the discussion is taking place. I don't mind it
being deleted, just don't edit it please.
Lucida
UK - Saturday, March 15, 2003 at 03:51:22 (PST)
BTW, there was a photo of Alan last night in the Evening Standard magazine. It was
taken at the opening night of Ian McKellen's Dance of Death. Sorry, no scanner!
Sarah
London, - Friday, March 14, 2003 at 23:26:35 (PST)
What was Alan wearing? Umm, black jacket, black shirt, blue jeans. Designer jeans?
They had stitching horizontally across the length about every 12 inches. He had his
sunglasses tucked into the front of his shirt, just where the collar opens. His hair
looked quite grey, especially at the sides. When he sat on the floor I noticed how thick
his hair was. He keeps it swept off his face, but from the back you see how dense it is.
Bill Nighy is a sweet man, I spoke to him. He said he'd never seen Blow Dry! Told him he
should as he was great in it. He gave me a wave when I left. I took some pix of Alan but
didn't speak to him this time. He attracted quite a throng of admirers wanting autographs
etc, but to be honest, it wasn't really that type of event. He was there for his political
beliefs not his fan-base? I felt awkward taking the photos I did, really, but was
powerless to stop myself!
Sarah
London, - Friday, March 14, 2003 at 23:18:42 (PST)
I also "discovered" AR from the HP movies!! I decided to finally watch
them during Christmas and there he was! That voice, those emotions, I was hooked! I've
been watching every AR movie I can. Was I the only one during the Chamber of Secrets
showing,watching a scene with Alan and wanting to shout out, "Rewind! Go back! Can I
see that again?" I've happily jumped on the AR bandwagon and will be along for the
ride!
Nina <nmai28@hotmail.comfoo>
TN - Friday, March 14, 2003 at 18:21:13 (PST)
This is the actual announcement re Alan's appearance on March 16, 2003:
LAST CHANCE TO BOOK TICKETS FOR...
The one night only, gala performance on 16 March at 7:00pm of Kids 4 Freedom!
The exciting new dance show by Kids Working 4 Kids is performed by a cast of highly talented inner-city youth from south London, aged between seven and 17. The show draws attention to the millions of children in slavery throughout the world today.
Held at the Linbury Studio Theatre, Royal Opera House Covent Garden, London, in the company of film stars and patrons of the event Alan Rickman and Jane Horrocks, all proceeds will be donated to Anti-Slavery International for its work.
To book tickets download the ticket form or contact r.dasani@antislavery.org
Kimberly
Michigan - Friday, March 14, 2003 at 18:02:05 (PST)
Alan will be appearing at another event in the UK on March 16, 2003. This event
requires a ticket. Here's the link: AntiSlaveryEvent
Kimberly
Michigan - Friday, March 14, 2003 at 17:52:30 (PST)
Check it out: the speech from which AR read at CDII: http://www.commondreams.org/views03/0212-07.htm
Sorry to be repetitive.
Dee
US - Friday, March 14, 2003 at 17:43:27 (PST)
I think your site is incredible,except that the photo gallery is not working.I meant
to say HAPPY BIRTHDAT to Mr.Alan Rickman but i couldnt get my computer to work.So hears
the late HAPPY BIRTHDAY!And I would like to say that I myself have talked to Rupert Grint
who has told me that Mr.Rickman is one of the nicest men alive and as proof he told me
that he had drawn a unpleasant picture of Mr.Rickman and Alan only laughed,rupert said
that he was having a party in a few days and that Mr.Rickman would be there and that i
could talk to him if i wanted because Mr.Rickman loved to talk to his fans.
sarah wish to be rickman <trish_jonasson@hotmail.comfoo>
Canada - Friday, March 14, 2003 at 17:09:37 (PST)
For Gawd's sake Sarah, what was he wearing? (Do you think I'm a bit shallow???)
Seriously, thank you for the info on CDII. And seriously, what was he wearing? How the
heck did he look?????
Dee
- Friday, March 14, 2003 at 17:07:34 (PST)
One of the anti-war coalitions reprinted Byrd's speech, as a full page, in the NY Times this past Sunday. It's a good choice for AR's fine voice and delivery.
Even when it's sunny and mild out, it's not entirely pleasant. Too much sand and too
many gas fumes in the air.
Lily
Chicago, IL - Friday, March 14, 2003 at 16:46:53 (PST)
Collateral Damage 2: I slunk out of work ten minutes early and got to the National
Theatre just before AR arrived. Despite that he got a seat and I didn't! No matter, he
quickly gave up his seat to someone and ended up sitting on the floor like so many of us.
There was quite a crowd. Corin Redgrave was MC tonight, i didn't see Jeremy Hardy.
Proceedings started with some very moving music by The Steve Bentley-Klein quartet. It was
from their New York suite, about the Twin Towers? Others who were there can correct me if
I'm wrong, it was all a lot to take in on the spur of the moment. Vanessa Redgrave was
there, too, but she didn't sing Stormy Monday as billed. She sang a Donovan song instead,
and read a poem, each line starting with A candle....It was by Hanif Kureishi? John
Sessions did a very animated and amusing skit on George W. and Tony Blair talking to each
other on mobile phones about the war. AR's bit (as mentioned by Eric below) was probably
the most serious part of the proceedings. He had our rapt attention and, after the
quasi-comical piece by John Sessions, it focused us all again as to why we all were there.
Bill Nighy appeared again tonight and amused/appalled us with a piece about his new
neighbour 'Ron'. A fictional neighbour, for according to the hand-out, the piece was by
Joe Penhall. Ron was a man on a mission: to get his local community to march with him and
torch the corner shop and kill the shopkeeper 'Abdul' and all his family. The finale was 3
poems read by Eileen Atkins and Anna Maxwell Martin. All very informal, all over too
quickly. As simple as a group of like-minded friends just getting together for an hour
after work, all sharing the same common bond, the same feelings. As ordinary as it was
extraordinary. Unique.
Sarah
London, - Friday, March 14, 2003 at 16:16:24 (PST)
Which Lisa, you also wrote a very good story on fanfic, (if you are the same one)I
read it really enjoyed it but after it was finished I deleted it from favorites. If this
is you please list you story id address for those looking for Snape stories.
Kim <kimtauchen@hotmail.comfoo>
USA - Friday, March 14, 2003 at 15:17:49 (PST)
I started to explain about the pen name I use, but I just can't do it on this page.
It involves something that happened a long time ago with someone who touched my heart in a
very special way. It may be silly, but when I share the story I want it to be one-to-one.
Anybody who really wants to know can email me at rbrlubber@aol.com I know this may seem
silly, but that's the way it is.
Carolyn, dear Carolyn
CO USA - Friday, March 14, 2003 at 15:01:26 (PST)
http://www.theatremania.com/content/show.cfm?int_show_id=19693 It's a short run. It
wasn't me that mentioned it, but I had looked it up and bookmarked it. Looks like a great
cast. Let us know if you go see it! **back to lurkdom**
witch lisa
- Friday, March 14, 2003 at 12:55:46 (PST)
did someone say that Juliet Stevenson was on Bway right now? I'm going to NYC soon
on business and wouldn't mind seeing her onstage, she was darn good in TMD! Of course, I
just spent 160 bucks to see Helen Hunt and Brent Spiner in Life x 3 while I'm there -- so
I'm about broke! LOL!
ch
- Friday, March 14, 2003 at 12:49:02 (PST)
The first half of the HP spoof was very funny :) The main Snape bit was in the Great
Hall and it consisted of him tlaking about his costume and wig. Very well done by Jeremy
Irons. At the end of that speech he said "God, I'm gorgeous!" Later there was a
shot of him preening in front of a mirror. :)
Zoe
UK - Friday, March 14, 2003 at 11:40:05 (PST)
I, too, discovered Alan by watching Harry Potter. The voice got me in, plus his face. Since then I've bought most of his movies.
SPOILERS about January Man. Some of you probably won't like this one, as there are no "Alan Willie" scenes. However there is an interesting sex scene between Kevin Kline and Mary E.
Carolyn, dear Carolyn, how did you choose your signature?
Just Wondering, dear, Just Wondering g
U.K. - Friday, March 14, 2003 at 11:31:21 (PST)
Eric, thanks for your Collateral Damage report. Here is a link to the speech from Senator Robert Byrd, of
West Virgnia, which Rickman read at the National Theatre event.
Renie
CA , - Friday, March 14, 2003 at 11:25:30 (PST)
Lils, all I can find on Wanda de Jesus is that she is also in Flawless and Gold
Coast. Maybe those websites will tell you something. Her birthdate is not listed in the
Videohound books. I loved Col. Brandon and Alexander Dane, but sort of never knew they
were the same person. It was Harry Potter that set me looking for more and realizing I
already liked this guy. Carolyn, DEAR Carolyn, it was the same for me. That voice and that
controlled whatever! Since then I've seen (and bought) a lot of his stuff, but most of the
movies as a whole are kind of dumb and boring when he's not in the scene. I like January
Man, though a lot of the movie is dull. I like Kevin Kline. However, Mary E. plays a 23 yr
old, and sweetie, that's about 10 years too young for her at that time!!!! Ed is a quiet
figure, but that's AR's way to make the character real, as he does all the time. I just
remarked to one of my patient family members that he doesn't seem to make the same kind of
movie twice, so each character is different. She nodded, sighed, and went on talking about
Elijah Wood.
kit
pa usa - Friday, March 14, 2003 at 10:27:08 (PST)
Hi there, I'm just out of Collateral Damage II. Excellent people. Your man read
Robert Byrd's speech at the senate about the disastrous consequences this war would have.
Very eloquent speech, very eloquent delivery. So glad of Mr Rickman's sensitive
involvement in this. Too many people are silent.
Eric
London - Friday, March 14, 2003 at 10:26:15 (PST)
TO UK GALS: We will get a report on "Collateral Damage" today I;m sure.
But can someone also give us a report on the French & Saunders "Harry
Potter" spoof that's on TV tonight? Saw a clip of Jeremy Irons doing Alan doing Snape
and it was a hoot... Thanks!
kate
san francisco, - Friday, March 14, 2003 at 08:28:01 (PST)
I was seduced by Severus Snape in the walls of Hogwarts. DH and I went to see Harry
Potterwith a skein of neices and nephews over Christmas Break, expecting an
over-hyped, syrupy children's movie. Wasn't it a surprise when the characters all seemed
to be interesting? And didn't Hogwarts seem an awful lot like monasteries I'd visited and
loved? Well...yes. And Snape just looked like a big cloud of tightly contained something
that was sure to happen eventually. All through the movie there were hints and
allegations, rumors and circumstances about who he was and what he might have done. And he
wasn't giving ANYTHING away. The tension just sort of set in and began to grow. Then, the
man opened his mouth and spoke and that voice was like a warm hand massaging my
tummy and breathing into my ear and I sat there thinking, "Aunt Carolyn, you are a
very perverse woman; this is a children's movie!" Just like Jimmy Carter, I was
guilty of lusting after someone outside of my marriage bonds. And, just like most
effective temptations, it was and is SO DELICIOUS.
Carolyn, dear Carolyn
CO USA - Friday, March 14, 2003 at 07:54:31 (PST)
I, too, fell hard for the Colonel. It started when he carried Marianne in from the rain, grew when he said "give me an occupation, or I will run mad," and peaked when he was reading from "The Faerie Queen." My infatuation was solidified after accidentally watching Harry Potter on HBO.
I was wondering what people think of AR when they watch a dubbed film. Does he have
same effect without the voice? (BTW S&S and Michael Collins have been running on HBO
all month.)
Dee
US - Friday, March 14, 2003 at 05:46:16 (PST)
I became infatuated with AR when I and A friend went to see Sense and Sensibility
because there was nothing else showing at the movies. We use to take it in turns to pick a
movie that we did not really want to see. When we saw AR we spent the rest of the evening
arguing over who was going to "have" HIM. Great fun and I have been hooked ever
since
Gissing'S girl
UK - Friday, March 14, 2003 at 04:24:20 (PST)
The March issue of Movieline magazine has an article called "Attack of the
Killer Second Bananas or 30 Actors Who Stole Their Way to Stardom", about actors who
have stolen a movie away from the star. Of course, this title practically screams
"Alan" and lo and behold, there's a bit about Kevin Costner getting his start
outshining Kevin Kline in "Silverado", and going on to be a star. Then it states
"But then the star turned into the solemn, predictable, self-absorbed Kevin Costner.
Before you knew it, Costner was getting upstaged by his second bananas. Alan Rickman in
RHPOT (though Rickman is not so much a second banana as an entire plantation of
bananas--all over them overripe..." LOL!
Angelina
CA USA - Thursday, March 13, 2003 at 22:29:14 (PST)
Actress-- not "author"
Lils
- Thursday, March 13, 2003 at 18:24:37 (PST)
Way off topic but does anyone know how old Wanda De Jesus is, the author opposite
Clint Eastwood in "Bloodwork". I am doing a report on her. I can't seem to find
her birthdate anywhere.
Lils
NY, NY - Thursday, March 13, 2003 at 18:23:51 (PST)
DEE: Re: "january Man" comments. I recently bought this for $1 at the used
video store. I paid too much. God, what a stinker! And it goes on forever! AR is adorable,
but not in it enough. I think he made this right after he ripped up his knee shooting
"Die Hard," because he walks with a noticeable limp in some scenes (the scene
where he's in Kevin Kline's office and Mary Eliz comes in for the first time is one of
them). As for the POLL, the AR movie that started my infatuation was "Fallen
Angels," the thing he did for Showtime cable in 1989 I think. Never saw or heard of
AR before and I was absolutely HAUNTED by him. Went straight out to rent "Die
Hard," and fell in love with Hans. I started dreaming about that "exceptional
thief" and having auditory flashes (I don't know what else to call them) of Hans'
voice. Then I sort of came back to my senses and enjoyed Alan like a normal human being
for years. But then, without warning, after watching "Sense & Sensibility" a
few too many times, obsession reared its sandy-haired-with-graying-templed head. And, so,
here I am, my noggin filled to the brim with naughty thoughts of muskets and Snape
detention. Thank heavens for the GB, or I might have to actually pay for therapy.
Kate
San Francisco, - Thursday, March 13, 2003 at 18:05:11 (PST)
CdC: I love your puzzles!!
Dee
- Thursday, March 13, 2003 at 17:20:03 (PST)
Okay, we've gotten the UK, Aussie, and US opinions (of all ages) on the willy thing--time to hear from the East, Netherlands, and France. Arrrrggghhhhh!!! Sorry!!!
I am renting "January Man" to watch for the first time this weekend. Any non-spoiler comments?
Poll: Which movie incited you to become AR infatuated?
Dee
US - Thursday, March 13, 2003 at 16:51:44 (PST)
Divine Brown, I suggest you try Listerine or maybe Scope.
Been there
Los Angeles, CA USA - Thursday, March 13, 2003 at 15:34:20 (PST)
Carolyn, dear Carolyn If only it could be that easy..spent 2 days last week getting rid of those "piles". Of course while I was doing that I was also watching AR in Robin Hood Prince of Thieves & Dark Harbor. It's a wondered that I didn't loss anything else because my mind wasn't on the bills or taxes. I know where my loyalties lay!!!
Loved your puzzles!!!!
Tina
Chicago, - Thursday, March 13, 2003 at 13:51:51 (PST)
I promise, no more posts today. Here's a list of all the puzzles I've made so far. Difficulty can be changed by clicking on "Shapes" to the left of the puzzle.
Texas
http://www.jigzone.com/ms/z.php?ui=297688i1845787511&z=51_piece_crazy
Snape Print 1
http://www.jigzone.com/ms/z.php?ui=297688i1845787777&z=50_piece_circles
Bollocks
http://www.jigzone.com/ms/z.php?ui=297688i1845787495&z=50_piece_tri_clip
Rickman in Rubber
http://www.jigzone.com/ms/z.php?ui=297688i1845784463&z=20_piece_classic
Off Topic/Poppy, One of my Birds
http://www.jigzone.com/ms/z.php?ui=297688i494663&z=20_piece_classic
Carolyn, dear Carolyn <landofthefree/homeofdepraved@outlook.comfoo>
CO USA - Thursday, March 13, 2003 at 12:23:34 (PST)
helo i am from holland and i think this is a fantastic site. :) doei!!!
sabina <sabina_lima@hotmail.comfoo>
breda, noord brabant nederland - Thursday, March 13, 2003 at 12:13:50 (PST)
Terri, you must know Dawn French from Vicar of Dibley, it's been on every PBS
station a dozen times in the last six years. Both ladies are on or write Absolutely
Fabulous (DF was the orginal Saphhie). I've seen both on the French and Saunders show and
admire their abitlities greatly. Both can really act as well as being great commedienes. I
hope we get to see this Potter thing; I love their other movie send ups, too!
kit
pa usa - Thursday, March 13, 2003 at 10:04:58 (PST)
Thank you, Cathy!
Lily
Chicago, IL - Thursday, March 13, 2003 at 07:57:49 (PST)
Another puzzle
http://www.jigzone.com/ms/z.php?ui=297688i1845787495&z=50_piece_tri_clip
You can change the difficulty by clicking on Shapes to the left of the picture.
Carolyn, dear Carolyn
CO USA - Thursday, March 13, 2003 at 07:54:09 (PST)
Krankenversicherung = health insurance btw. I know--you all know that already.
Dee
- Thursday, March 13, 2003 at 07:34:40 (PST)
Thank you, Claudia, for your prompt reply.
So, those funny Harry and Ron who appear on the trailer must be French and Saunders....
(^o^)
Terri from Far East
- Thursday, March 13, 2003 at 06:24:07 (PST)
OMG, Terri...IMO, French and Saunders are THE funniest comedy team in the UK. And
they are hilarious on their own as well.
Claudia
GA US - Thursday, March 13, 2003 at 05:45:46 (PST)
Sorry, but here is a simple question...
Who are French and Saunders? Are they comedians? Are they famous in the UK?
Terri from Far East
- Thursday, March 13, 2003 at 05:31:41 (PST)
CdearC, I stand corrected! Willy and Fries DO indeed rhyme! Who'd have thought this
possible until now? However, I do believe YOU could make ANY word rhyme with Willy. When I
grow up I want to be just like you! You're a LEGEND!!!!
Aussiegirl
- Wednesday, March 12, 2003 at 22:59:39 (PST)
http://yacht.zamok.net/DV/Potter/Posters/Snape/index.html Here is the link to the
page where I got the pics..Have fun!!!!!
Cathy
FL USA - Wednesday, March 12, 2003 at 21:02:30 (PST)
http://yacht.zamok.net/DV/Potter/Posters/Snape/Risunki/yo.jpg Thanks for the help
Dee! Here is the link to the pic. I hope you enjoy!
Cathy <snapefan2@aol.comfoo>
FL USA - Wednesday, March 12, 2003 at 21:00:07 (PST)
That Hugh. Does anyone else here think that he made a big mistake with Divine? On to more important things . . .
okay. I'll try this one more time. I have done a Snape jigsaw puzzle, although it is on shockwave.com not jigzone. If you cut and paste the link, you will need to have shockwave in order to do the puzzle. If anyone likes it, I will do a Colonel Brandon jigsaw (sans sheathed musket). http://www.shockwave.com/bin/content/jigsawmaker.jsp?doc=195607/1047050792225_14
Cathy--just cut and paste the link onto your post--I'd like to see that picture too.
By the way, CDC, how are you conditioning your couch--email me?
Dee <deebartholomew42@yahoo.comfoo>
- Wednesday, March 12, 2003 at 20:17:09 (PST)
Comic Relief is showing on BBC-1 Friday March 14. For more info and a funny preview
of 'Harry Potter and the Secret Chamberpot of Azerbaijan', check out Comic Relief. Click on 'Harry
preview'. Very French and Saunders (and Jeremy Irons, Miranda Richardson...)
Silvia <millamant99@yahoo.comfoo>
- Wednesday, March 12, 2003 at 19:46:04 (PST)
Shizuka Dream: After repeated viewing, and after just listening while conditioning
the couch [it's arid in CO and I don't want to think all those Italian cows died in vain]
the very best thing you sent on the dvd's was the "Hard Talk" interview. In the
last few months I've accessed so many interviews that are set up for short silly answers
to short silly questions that this was really satisfying. I especially pricked up my ears
at what AR said about the actor as story teller. It's a shock when somebody screws up on
stage and, all of a sudden, you're not watching a story unfold; it's just actors speaking
lines or going through prescribed motions. It's like the actors and the audience entered
into a pact agreeing to a "willing suspension of disbelief" [as it was put in a
class I took] and somebody reneged on his part of the contract. Fantasy and imagination
are such wonderful gifts, free and available to all, but I am very grateful for the people
who facilitate accessing them when reality is too much with us.
Carolyn, dear Carolyn
CO USA - Wednesday, March 12, 2003 at 19:29:32 (PST)
Dee: DH fixed up Internet Explorer and I ran your puzzle. Love it! That is so cool! Put up some more, okay?
Aussiegirl: I wanted to send this via email but couldn't, so here goes...prize of size
betwixt thine thighs brings on sighs until it dies. See, willy rhymes with fries. Oops, I
lies.
Carolyn, dear Carolyn
CO USA - Wednesday, March 12, 2003 at 19:06:09 (PST)
Stop bagging Hugh Grant!
And all this talk about Willies is leaving a bad taste in my mouth. ;0
Divine Brown
Los Angeles, CA - Wednesday, March 12, 2003 at 18:20:17 (PST)
Ella, You crack me up! LOL..I was laughing so hard DH came to see what was up!He
read your post! LOL.. DH is now walking around the house singing that tune, AND has both
our boys (6 and 10) ROTFLOBO!! They think saying ding-a-ling and willy are funny! LOL...My
sides hurt now!
Cathy <snapefan2@aol.comfoo>
FL USA - Wednesday, March 12, 2003 at 18:08:28 (PST)
Lily, I found the pic you were looking for. email me, as I can't figure out how to
send the link to the GB. Anyone with suggestions on how to do that let me know, and I will
gladly share!
Cathy <snapefan2@aol.comfoo>
FL USA - Wednesday, March 12, 2003 at 17:58:23 (PST)
Oh sorry, last comment for the night--Ali-Pat, girlfriend, you hit the nail right on
the head!! That damn short-sleeved t-shirt over AR's lovely, tempting bulging bicep in GQ
makes me drool every dingle-samn time I see it (which is a lot). Isn't that odd??? Yes,
you might start something again . . .
Dee <ARbulgingbicepfanclubfoo>
- Wednesday, March 12, 2003 at 17:55:06 (PST)
Oh, and Ella, there are those of us here who appreciate you greatly.
Dee <Notyoungandhappyaboutitfoo>
- Wednesday, March 12, 2003 at 17:46:38 (PST)
Dee, Just trying to "Lift the Tone" of the GB so the "Thought
Police" don't spit their dummies again!
Aussiegirl
- Wednesday, March 12, 2003 at 17:46:36 (PST)
Oh gosh, Aussiegirl, yeah baby!!! :) (Note Aussiegirl's excellent AR tie-in!!!)
Ella: you must know that Bob Roberts would never say "ding-a-ling." But he
might say WILLY!!!!! OOOPS!!
Dee <ILoveFrenchFriesfoo>
USA - Wednesday, March 12, 2003 at 17:42:46 (PST)
Ella, I did try r-e-a-l-l-y hard to rhyme FRIES with WILLY but, try as I might, I
just couldn't get it to work!
Aussiegirl
- Wednesday, March 12, 2003 at 17:42:31 (PST)
Or maybe Bob R. is, ahem, singing that old Chuck Berry song. Uh, you know the one...it goes a little something like this... When I was a little bitty boy My grandmother bought me a cute little toy Silver bells hangin on a string She said it was my ding a ling a ling Oh my ding a ling, everybody sing I wanna play with my ding a ling My ding a ling, my ding a ling... I wanna play with my ding a ling When I started grammar school I used to stop off in the vestibule Every time that bell would ring I'd take out my ding a ling a ling Oh my ding a ling, everybody sing I wanna play with my ding a ling My ding a ling, my ding a ling... I wanna play with my ding a ling When I was climbing the garden wall I slipped and had a terrible fall I fell so hard I heard bells ring But held on to my ding a ling a ling Oh my ding a ling, everybody sing I wanna play with my ding a ling My ding a ling, my ding a ling... I wanna play with my ding a ling Once I was swiming though Turtle Creek Man, little snappers all around my feet Sure was hard swimming across that thing With both hands holding my ding a ling a ling Oh my ding a ling, everybody sing I wanna play with my ding a ling My ding a ling, my ding a ling... I wanna play with my ding a ling This here song, it ain't so sad The cutest little song you ever had Those of you who will not sing, you must be playing with your own ding a ling Oh my ding a ling, everybody sing I wanna play with my ding a ling My ding a ling, my ding a ling... I wanna play with my ding a ling Oh my ding a ling, everybody sing I wanna play with my ding a ling My ding a ling, my ding a ling... I wanna play with my ding a ling. ~Dedicated to the stodgy old girls on the GB ;-)
Yeah, baby.
Ella <Perpetuallyyoung-at-heartistheonlywaytobe@wheeeee.comfoo>
PA USA - Wednesday, March 12, 2003 at 17:38:33 (PST)
CDC: Ooooooooooh!! Can you share the picture?? What fun. (And what did you send as a present, hmmmm?)
As I was looking (in vain) for Lily's pic, I happened across a site called "Telegiraffe." (http://members.tripod.com/DailyTelegiraffe/potter2.html) It was mostly dedicated to Kenneth Branagh, but had lots of interesting little tidbits about AR--like drinking until 4:00 a.m. with Branagh and Richard Harris while filming "HP and the Chamber of Secrets"--and lots of pics and even info about AR's involvement with "When Love Speaks." Perhaps I'm behind the times, but I thought I'd pass it along.
To all those headed for CDII, have fun, and report back soon!!
Dee
- Wednesday, March 12, 2003 at 17:37:31 (PST)
FREEDOM Fries???!!! Bob Roberts Lives!!!! Maybe he's whipping up a song about them as we speak -
"We don't swallow Saddam's lies.
We're too busy gobbling FREEDOM FRIES!"
Aussiegirl
- Wednesday, March 12, 2003 at 17:16:36 (PST)
This past summer I saw a photo of AR in costume as Snape, wig and all, wearing a
pair of Lennon round wire-rimmed shades and a peace symbol necklace. I think the photo was
linked to a post on the GB (I could be wrong) but the message didn't say much, just
"look here" or something like that. Before I lose my mind going through all the
2002 archives, and finding I can't "refresh" many of the links or the page has
"expired", perhaps a reference librarian or an archivist here has a copy or
could put up a fresh link to the photo? Nope, I'm not enlarging the image to carry as a
sign in any demos.
Lily
Chicago, IL - Wednesday, March 12, 2003 at 16:29:14 (PST)
Only one day left before going to London. I will surely give you a full report of
the CDII as well as the Dance of Death. I hope that meeting Alan again will bring me luck
for my interview!!!! I can imagine how would be life in London knowing that AR also live
there....A lot lightier.
Nathalie
Paris, - Wednesday, March 12, 2003 at 15:39:18 (PST)
Carolyn,
That's great!!! I'm so glad to hear you got that. And yes, I'm sure he's using it!!! That's great!
You owe me a scan!!! Just curious, what does the picture look like?
Jayne Claire
Auburn, AL - Wednesday, March 12, 2003 at 14:44:35 (PST)
Ali-Pat, I would love Judas Kiss and January Man, if they are not taken yet. I tried
to email you, but they camed as undeliverable! Thanks, Susan
Susan <autumnfall56@yahoo.comfoo>
- Wednesday, March 12, 2003 at 13:56:44 (PST)
What a nice surprise! I got a letter and an autographed photo from Melanie Parker, "For and on behalf of Alan Rickman" thanking me for his card and birthday present. Isn't that sweet? His mama must've raised him right!
Jayne Claire: I told you what the present was--don't tell anybody. Do you think he's
using it? giggle giggle giggle .
Carolyn, dear Carolyn <whenelephantsfightitisthegrassthatsuffers@anywhere.comfoo>
CO USA - Wednesday, March 12, 2003 at 13:50:56 (PST)
Ali-Pat have sent you an e-mail but not sure that you got it. Please can I have a
copy of Quigley Down Under and Galaxy Quest if you still have them. Idon't mind paying
postage for such treasures. I have tried to get them locally but the people in the video
shop just look pityingly at me when I mention Alan Rickman. Thanks Gissing's Girl
Gissing's Girl <insley@thewind.fsnet.co.uk
foo>
UK - Wednesday, March 12, 2003 at 13:37:28 (PST)
Tina: Look where there is a pile of envelopes.
Carolyn, dear Carolyn
CO USA - Wednesday, March 12, 2003 at 12:11:18 (PST)
Love the site! great info. on one of my favorite actors! I have always thought that
Rickman was one of the most gifted actors I have seen in a while, not your usual
"Hollywood-type Actor" either(Definately a plus) HOpe to see him in more in the
future. Thanks for the web site and keep up the great information.
wendy newlin <wnewlin@unch.unc.edufoo>
mebane, nc usa - Wednesday, March 12, 2003 at 12:08:51 (PST)
Ali-Pat - Alison Steadman is playing McGonagall, Nigel Planer (Young Ones etc) is
Dumbledore (using the real hair and wig apparently!) and Hagrid is a secret till Friday!!
Not pictured are French and Saunders who play Harry and Ron repectively. I think Miranda
Richardson (Blackadder etc)is Hermione.
Sue
- Wednesday, March 12, 2003 at 11:18:12 (PST)
I, like Claudia, have been out of it lately also. But, as a famous Irish leader has been quoted as saying, "I see you have been having fun in my absence."
Sue--loved the photo of the new Hogwarts cast, but I can't make out the caption. I recognize Jeremy Irons, of course, but not the other three.
Dee--I fall apart every time I see Alan/Alexander/Lazarus in that tee shirt in GQ. What that man can do for a simple piece of cotton knit is miraculous. (Oh dear, I'm afraid I'll start something with that comment...)
Dear Carolyn--you clever thing! You have managed to combine two of my favorite time wasters, AR and Jigzone! Thanks for the diversion (as if I needed one). And thanks also for that Aquarian ode. (And stop thinking about cotton knit undergarments, naughty girl).
The Great Video Bonanza continues apace, but I still have some copies left. I will
begin sending videos out on Monday if I don't hear from anyone else. Titles still up for
grabs:
The January Man
Quigley Down Under (many)
Judas Kiss (one left)
Galaxy Quest (one left)
Ali-Pat, still broadcasting remotely <sa.pe@earthlink.netfoo>
Dayton, OH USA - Wednesday, March 12, 2003 at 11:10:49 (PST)
"GML: speaking of the French, I read today that the senate lunch room (or something like that) has renamed french fries "freedom fries." - Indeed? Well, well, it is only time for this administration to acknowledge the role the French played in the American fight for independence from the Brits! (tongue in cheek;) - "(I will order nothing but french fries here.)". LOL, thanks Dee, you could even order 'frites' which is what we call them. Yes, no only are 'French fries' actually Belgian in origin, neither the Belgians nor the French call them 'French' so I suspect that while this might give official encouragement to xenophobia in the US, it is going to cause a certain amount of hilarity in France. Looks like Bushisms are contagious, beware! ;)
Well, it looks like several people are concerned enough about the international situation to go to CLII (t-i-c), excellent: we'll get several reports I hope :). Alan Rickman and Terry Jones... were both in Help I'm a Fish. Do you reckon Alan will sing the 'Intelligence' song? (y'know, the evil fish who wants to dominate the waves ;). If so, don't tell me, I would never recover from having missed that. (By the way, I typed a more complete report of CLI on Claire's off-topic page for those interested in the events. Uh, I've forgotten what the page is actually called. )
GML
UK - Wednesday, March 12, 2003 at 10:37:08 (PST)
Georgiana,
Hope you have a safe and pleasant trip!
Kudos
Jayne Claire
Auburn, AL - Wednesday, March 12, 2003 at 10:10:26 (PST)
Re 1961-62, 1971-72: Egads! Can everybody now tell why I barely passed high school
math and went into the Humanities at University? At least in Art History we only memorise
numbers, and don't manipulate them in any way! So sorry for my blatant arithmetic error.
Is there a Math Queen on this GB, like there is an English Queen? :)
Julia
Calgary, Canada - Wednesday, March 12, 2003 at 10:10:04 (PST)
Hello...I've reading this GB for a while and finally have decided to post.
This is the only thing that kept me "sane", It's been a long time since I've
laughed so hard....Now if I can only find my mortage payment book. Thanks!!!!!!
Tina
Chicago, - Wednesday, March 12, 2003 at 09:30:01 (PST)
Barring act of God or war, yes, Kimberley. Will do.
Georgiana
Seattle - Wednesday, March 12, 2003 at 09:16:49 (PST)
Georgiana: Are you going to the NT Collateral Damage event? If so, please bring us a
full report. And....Have a wonderful time!!
Kimberly
Michigan - Wednesday, March 12, 2003 at 07:38:17 (PST)
Thank you Georgiana...I have been out of it lately. Promise to improve as soon as I
can. BTW, your pics will be sent this evening (EST)...sorry for the delay. And have a
wonderful trip!
Claudia
GA US - Wednesday, March 12, 2003 at 07:36:03 (PST)
Claudia, that's the April "Hollywood" issue previously mentioned--the
picture that was posted of the cast from "Love Actually."
Georgiana (off to London for the weekend...)
Seattle - Wednesday, March 12, 2003 at 07:06:34 (PST)
Thanks for the heads up, Robin. Which issue?
Claudia
GA US - Wednesday, March 12, 2003 at 06:51:47 (PST)
CDC: Now I'm not going to be able to get that song out of my head for the rest of
the day. . .
Dee
- Wednesday, March 12, 2003 at 06:39:44 (PST)
our man is in the new Vanity fair
robin
USA - Wednesday, March 12, 2003 at 06:39:16 (PST)
To Getting Bored/Not one of the girls, my goodness, we have to have a bit of
JOCULARITY sometimes..... and I don't think AR would mind a bit - if he did, maybe he
would POST here? Times are changing, and I feel we all need to laugh a bit more.
Aussiegirl, Bill Nighie, was in Blow Dry, wasn't he? He was the one who was AR's
competitor at the end? His daughter liked AR's, character's, son. Had a good giggle on the
weekend as "George of the Jungle" was on!!! I still feel that AR would have
missed THAT Tree!!!
Barbara the Australian <Hermione_3@hotmail.comfoo>
Gold Coast, Qld Australia - Wednesday, March 12, 2003 at 05:17:16 (PST)
CdC, Well, my time was terrible but I enjoyed your puzzle this morning. Lovely way
to start the day.
Cindie
- Wednesday, March 12, 2003 at 04:49:03 (PST)
Ah dear Nathalie, yes thank you for my detention reminder. For the sketches did not amuse Snape. I made the other night, at the party. These are the things artists must suffer.
See... all this willie talk. I did warn you all about the inciting a penis envy riot.
Liked the jigsaw CDC
And !!!!! If you think this is crap look around at others sites for this site is
positively highbrow, in comparison (even when we get silly )!
Janine
Melb, Vic Australia - Tuesday, March 11, 2003 at 21:52:29 (PST)
Oh, and Georgiana, yes, the news page is most definitely being read.
Dee
- Tuesday, March 11, 2003 at 19:27:09 (PST)
Carolyn, dear Carolyn: fabulous puzzle!! Ask your DH to download shockwave so you
can try out the silly Snape ones I did. I would like your opinion very much. Sue: I would
love to see the French and Sauders parody--I wish the BBC would send more satellite
signals to the US. GML: speaking of the French, I read today that the senate lunch room
(or something like that) has renamed french fries "freedom fries." (I will order
nothing but french fries here.) Let see, where was it that I heard "it takes a great
deal of courage to stand up to your enemies, but a great deal more to stand up to your
friends?" (I.e, the French are standing up to us.) (Please note tie-in to AR film
here . . .) Anyhoo, Kate: your DH thinks AR runs like a girl because he's jealous (poor
man!!) :)
Dee
French Fry, USA - Tuesday, March 11, 2003 at 19:20:13 (PST)
Georgiana, Thank you for the time you devote to updating us with news of The Man.
That is my "newspaper" each day after work. Keep up the good work..
Cathy
FL USA - Tuesday, March 11, 2003 at 18:41:58 (PST)
THANK YOU!! Georgiana, I read the News Page everyday to see what's up with AR..[P]As
for !!!!, Willy, willy, willy!!! lol...
ARfan
USA - Tuesday, March 11, 2003 at 18:38:28 (PST)
A few comments tonight-Yes, Giorgianna, I read the news page every day and thank you for posting all those interesting articles.
As for the continuing discussion of Alans "private parts", Enough already,I feel like I am reliving my junior high years.
There was a nice review of Juliet Stevenson, in a Sondheim play, in todays USA
Today.They were very praise worthy. Wonder if Alan will cross the pond to see her?
Troy08
Lewiston, Me - Tuesday, March 11, 2003 at 16:37:29 (PST)
Shizuka Dream: You are a stellar human being! sparkle sparkle! GBers: She sent me four dvd's of AR today! Thank you, thank you, little star! What's your screen name about?
Sue is sending me Galaxy Quest! Surely this is the best of all possible worlds!
Oh, the humanity! "Harmony and understanding, sympathy and trust abounding, no more
forces of division, only living dreams and visions, mystic crystal revelation, and the
mind's true liberation!"
Carolyn, dear Carolyn <favsbeatlesrobbierobertsonclashrandynewman@mine.comfoo>
CO USA - Tuesday, March 11, 2003 at 16:08:38 (PST)
Carolyn, dear Carolyn: loved the puzzle. Also, I just got the highest score of 42
seconds! Not that it'll last that long, though! Tee Hee. ;o)
Katie c
USA - Tuesday, March 11, 2003 at 16:07:12 (PST)
To: !!!!
If the GB is so bad, why are you even reading and posting here? Or, perhaps, you could
add something of quality as a model for the rest of us poor sods to follow. Then, with
your stellar posts as a guide, we might be able to lift ourselves from the low depths of
mediocrity we now find ourselves. ; )
Kimberly
- Tuesday, March 11, 2003 at 15:13:21 (PST)
Yes, Georgiana, some of us read the News Page. It's the only place to get real
information. The GB is mostly cr_p these days.
!!!!!
- Tuesday, March 11, 2003 at 13:08:58 (PST)
Thank you, Sue! Wish I could've rotated it 90 degrees before posting it, but my
computer kept freezing in the process.
http://www.jigzone.com/ms/z.php?ui=297688i1845784463&z=20_piece_classic
Carolyn, dear Carolyn <favs:PoguesNickCaveRyCooderRichardThompson@
mine.comfoo>
CO USA - Tuesday, March 11, 2003 at 13:05:34 (PST)
GML - Well I think Saddam's 'tache is more *bog-brush* than *Jamie* so I think we
might have to let AR pass this one up. Maybe Alfred Molina is more suited!!!
Sue
Only a *Frog* can get a way with posting that!!LOL, England - Tuesday, March 11, 2003 at
12:47:51 (PST)
Gaaasp! This might be the end of Alan's career!... As a screen villain, that is ;)
"US puts new bad guys in the picture
British actors always seemed to play villains in Hollyood movies, but growing American anger with France could soon change that. Julian Borger explains
The Guardian, Wednesday February 12, 2003
Although Tony Blair's fulsome support for George Bush's administration may not buy him influence in Washington, it has at least made one important gain for his somewhat less stalwart countrymen: Britain is no longer obliged to supply Hollywood with all its bad guys. In the wake of the Paris-led defiance of US war plans, Britain's cross-Channel neighbours have been earmarked as general-purpose villains. The news from Beverly Hills is that producers are telling scriptwriters to 'think French'.
This is a relief. For years, a British accent in a mainstream movie served as cinematic shorthand for shiftiness or downright evil. Now we can at least hope for a return to an older cinematic tradition in which the British are loyal sidekicks, chirpy corporals or colonels in the mould of David Niven.
(...)
George Bush accused his critics of sipping chardonnay. His son voiced suspicions that the journalists covering him spent their free time nibbling French cheese. But the war on terror, and the sense of vulnerability that it has instilled in the US, has sharpened transatlantic distrust. There is a new rancour in an increasingly conservative media, directed at all critics of the US military response to September 11, be they American liberals, Arabs or the French.
The Germans have, so far, got off relatively lightly: mention of "krauts" on web chatrooms is far less frequent than talk of "frogs" (...) Most importantly, the Germans do not have a veto on the security council. (...) If the French use their veto, expect to see plenty more Gallic villains on the screen at your local cinema."
LOL!
Oh, I have to quote Georgiana's News Page to make this 'On Topic'. Differing opinions there it seems... :D
"WELL it's too late for Saddam. The Americans are itching to get on with it and they will.
There's no other possible scenario. They've committed more than a quarter of a million troops and they've made plans for after the war. Damn it, they've probably even sold the film rights and so they'll have to get a move on because Bruce Willis, who will take Baghdad single-handed before killing Saddam, has four other movies to do this year. Incidentally, if a film is made, what's the betting Saddam's played by an Englishman (think Alan Rickman, Jeremy Irons, Alfred Molina)?
GML (ROTFL)
UK (not been kicked out yet;) - Tuesday, March 11, 2003 at 12:35:03 (PST)
Nice puzzle CdC!!
Sue
- Tuesday, March 11, 2003 at 11:25:49 (PST)
After such a night with Snape some of you might have detentions
(thanks to The Wallpaper inc).
Nathalie
Paris, - Tuesday, March 11, 2003 at 11:04:11 (PST)
Come and see the AR portrait I carved in rubber! It's a puzzle, but I made it easy.
http://www.jigzone.com/ms/z.php?ui=297688i1845784463&z=20_piece_classic
Carolyn, dear Carolyn
CO USA - Tuesday, March 11, 2003 at 11:00:37 (PST)
Does anyone know if the French and Saunders HP will be shown on BBCAmerica? I loved
the Lord of the Rings and Braveheart they've done! Dawn French has a new show opening the
West End soon. I hope I can see it as we may be in England in June. I think A Little Night
Music will still go on as it is at the New York City Opera and is not a Broadway show; it
may even be a different union. I wouldn't plan on much else tho, and if the theatres get
their way to go more computerized, all musicals will be disappointing (so speaks a LIVE
musician. If you see The Pianist, towards the end there is a very hot looking Polish actor
who looks a great deal like a 1940's AR; even my husband noticed that! He is the husband
of the woman who helps save the star. (Who looks just like the other woman who helps
him.)Watching an uncut Die Hard today; I've never seen it without commercials and with
swear words! Thanks to AliPat!
kit
pa usa - Tuesday, March 11, 2003 at 10:53:02 (PST)
Georgiana - In answer to your question "Does Anyone read This Page?" on
News and Info - YES, but as we don't seem to have the access you have to add things, we
cannot comment, add or thank.
Sue
England - Tuesday, March 11, 2003 at 10:10:37 (PST)
I just wanted to say that I am impressed by Alan Rickman's involvement in the
theatre world's response to war. It is part of a real writer and actor's work to provoke
thoughts and remind us of past mistakes logged in history and literature when governments
on all sides are spreading dangerous propaganda and indulging in childish name-calling. I
am pleased he has not let fear of losing part of his audience stop him and I hope he
continues to do his bit to support his active friends.
Just a citizen
England - Tuesday, March 11, 2003 at 10:01:43 (PST)
French and Saunders are doing Harry Potter spoof for Comic Relief on Friday. Here is
a Picture of the new
Hogwarts Staff
Sue
England - Tuesday, March 11, 2003 at 09:35:17 (PST)
Anyone heard anything else about the virginia woolf potential show after POA
finishes filming? I'm going to NYC to see Bernadette Peters in Gypsy, assuming the strike
truce holds, and I thought I'd check...
ch
- Tuesday, March 11, 2003 at 08:42:17 (PST)
Hi, Constance. Re: "Strange Weeks" among females--I hope he'd understand
and forgive. After all, don't men have strange weeks every day of their lives?
Lee
- Tuesday, March 11, 2003 at 08:23:11 (PST)
Wanda, try googling RexFeatures. It's a British celebrity photos sales service,
mainly papparazzo stuff at openings.
FastFilm
L.A., - Tuesday, March 11, 2003 at 08:17:35 (PST)
Claire & Renie, thanks for the link and chat area. I found Claire's off-topic spot once during the past year but you've now made it a lot easier to visit. I'm reminded that it's been nearly a year by today's photo of Juliet Stephenson (correct spelling?!) and Jeremy Irons in silk bathrobes for "A Little Night Music"....It's a bit like deja vu all over again. (Don't think they can open without an orchestra.)
Yes, Nathalie, I think he is, although I recognize the thought is trivial, unimportant,
silly, beside the point, off-topic, all the rest of it. In the end, handsome is as
handsome does. And this has been a handsomely, helpful road block.
Lily
Chicago, IL - Tuesday, March 11, 2003 at 07:36:17 (PST)
Kim thank you for all the Snape References, I'm very grateful- it looks like it is
going to take me a long time to read everything- what a hardship! Carolyn dear Carolyn
what a relief to find that there is someone else in my age group that is nuts about AR.
People just don't understand these things especially one's nearest and dearest. My
daughter refused to be seen out with me wearing a Snape scarf.Re the recent accoutrements
discussion Iwould go for THE VOICE anytime over anything else. Imagine listening to that
any time you wanted to
Gissing's Girl
UK - Tuesday, March 11, 2003 at 06:58:51 (PST)
This is such a great site--including the section with links to interviews!
(Mortianna is quite right about the infamous quote. I read it in one of the interviews
right here!) I think that AR is fabulous and very funny in "Galaxy Quest" (ahem,
"GQ"). There is a scene where AR is talking to Sigourney Weaver on the phone,
and even though Alexander Dane hates his GQ character, he's walking around his apartment
looking into the fridge with that silly head on. It never fails to make me laugh. I know
most of you prefer his more serious roles, but as a divorcee who falls apart every time I
see "TMD" (in spite of that moustache), I truly appreciate AR's comedic talents.
(See, I didn't mention the "word" okay?)
Dee
- Tuesday, March 11, 2003 at 06:25:13 (PST)
Okay so..... are we all Willied-out? Have we got it out of our system yet?
Thank you, Mortianna for remembering me but let it be said that I admire ALL aspects
of the man and yes, he is lovely down there and all BUT I DO cringe when I imagin that,
prompted, inspired even by this Guest Book's kind donation to RADA in honor of his
birthday; He, The Man, decides to sneek a peek (or asks a friend to look for him), to get
a feel for WHO we truly are, and what does he read? :~O !!!Yikes! Rampant Willy Mania! It
would be too unfair to haver us judged by a strange week (most likely hormonally
induced), quite out of character for us, right? Or did I accidentally log on to Yahoo's
Alanwenchs by mistake!LOL ( no offence to the members, mind! But they are PRIVATE/
NC17, whereas we are not!) Okay! Pompous, school-marm Constance is done, for
now......anyway!
Constance
USA - Tuesday, March 11, 2003 at 05:10:24 (PST)
Mortianna--that interview was the exact one I was thinking about. So....The Man didn't say "the word"...but I knew it was in there somewhere! My memory sucks these days.
No, Suzanne has no aversion to hints or satire. Having a s***load of email about something so silly is not a pretty sight. And believe me...there are plenty out there that would think such a post actually was from The Man--it has been demonstrated time and time again in this GB.
On the date range for being one of "the girls"...I kinda sorta resent that! I
would hope that I am one of the girls and I certainly am not from the 61-62 or 71-72
range.
Claudia (who won't divulge what range she is from)
GA US - Tuesday, March 11, 2003 at 04:07:29 (PST)
i forgot to add to this willy discussion (boy, have I been growing up lately, a year
ago I would have jumped into it, the topic, that is). if I recall right (and I think I
do), it was not even AR who mentioned the size of his whatever (not that I think it
matters. I think it was Constance, who said, she was more interested in what was between
an man's ears, not between his legs. And if I further remember correctly, she added the
eternal phrase: have you seen one, you have seen them all. but I digress), AR said in an
interview that in show business it all depended on the size of people's - and then the
reporter jumps in: willies? And AR says: I was going to say wardrobes (for the
scientifically interested: note the link to GQ). "it is in the book" (S+S
diaries) - that is on Claire's page, somewhere. if anyone has difficulties with this post,
or feels so dizzy that she wants to go to bed again, I'm ready to bring on the
footnotes:-)
mortianna
the guestbook archive teller, adding to confusion - Tuesday, March 11, 2003 at 00:56:15
(PST)
sue yeah, I noticed just after I posted (story of my life). I think I must
have been blinded by the glasses... you mean the short one in the back is famous? yeah,
now I see it - must be Harry Potter, a bit grown-up. That is the cast of HP7, isn't it?
mortianna
in hiding, - Tuesday, March 11, 2003 at 00:49:12 (PST)
Hello fellow girls. I feel a little responsible for starting the naughty talk with
my remarks about the Colonel's musket. Not guilty enough to stop thinking about said
musket though. But... I just thought I'd share this amusing thing that happened to me
yesterday that is not at all musket-related. (awwwwwww!) The newspaper was open to the
arts page and I was doing something else and sort of glancing over and I saw a picture of
Alan, but when I grabbed it, I realized it wasnt Alan. It was his Separated At Birth
doppelganger: Michael Tilson Thomas, the conductor of the San Francisco Symphony. Take a
look at this guy! He looks like Alan as Sinclair in "Close My Eyes." There's a
pic at www.vanwalsum.co.uk/amd/artists/mtt.htm if anyone wants to see. Sorry, don't know
how to do a link. I'll add my vital stats: 45, mother of one, married, DH does not
understand AT ALL. Never has, about any of my, um, crushes. Never will. So I kinda have to
keep the ol' obsession quiet, which is very difficult sometimes, like when we were
watching Galaxy Quest and DH opined that "Rickman runs like a girl." Ah, my own
private hell... Only four days till the next girls' night out!
Kate
San Francisco, - Monday, March 10, 2003 at 22:45:39 (PST)
I did see anypost that "could be" Alan..where? which way did he go? LOL...
out of lurkdome
USA - Monday, March 10, 2003 at 22:15:12 (PST)
Well, I don't think you realize that a lot of people would have thought it
was him. A couple years ago someone posted an even sillier post and I was flooded with
e-mail from people wanting to know if it was really him! So take it from me, I know from
experience, that's a joke better left un-posted.
Suzanne <Suz@mail.usa.comfoo>
TX USA - Monday, March 10, 2003 at 22:01:32 (PST)
Ella, back atcha.
!!!!!
- Monday, March 10, 2003 at 21:59:08 (PST)
Dear !!!!!, :-P
Ella
p USA - Monday, March 10, 2003 at 21:53:35 (PST)
Oh for... I somehow think The Man would find something so obviously satirical amusing. I really do. It wasn't meant to be serious and I think everyone (of at least average intelligence, and most on the GB seem above that) would realize that AR hadn't actually done the posting. But to each her own. Sorry for putting a bee in your bonnet.
Ella
PA USA - Monday, March 10, 2003 at 21:48:44 (PST)
No, everyone is allowed to be silly once in awhile. Especially in these stressful
times. But I do have an aversion to people impersonating Mr. Rickman. NOT cool, not
allowed. Thank you.
Suzanne <Suz@mail.usa.comfoo>
TX USA - Monday, March 10, 2003 at 21:41:38 (PST)
????? Do you have an aversion to hints?
!!!!!
- Monday, March 10, 2003 at 21:35:55 (PST)
Suzanne, do you have an aversion to satire?
?????
- Monday, March 10, 2003 at 21:29:09 (PST)
I was born in that time frame. And frankly, I'm sick of the constant yammering about
the size of Alan's p_nis. Can we stop now?
Not one of the Girls
- Monday, March 10, 2003 at 21:28:30 (PST)
Julia, if my calculations are correct..to be "one of the girls" you would
have to be born in 1971-72...not 61-62.. signed, "one of the girls"..lol
"one of the girls"
USA - Monday, March 10, 2003 at 20:45:42 (PST)
AR's comment in the Conan O'Brien videogram that aintitcool.com called "Galaxy
Quest" the greatest movie ever made is commented upon at aintitcool.com if you cut
and paste to the following link: http://www.aintitcool.com/display.cgi?id=4897. Just in
case anyone is interested.
Hermoine Granger
- Monday, March 10, 2003 at 20:45:12 (PST)
Barbara the Wal-marter, I too have sought videos at Sam Walton's store. But in this
case, I have a boatload of spare videos I am trying to give away, not purchase (for
a change). Thanks for the advice, anyway...
Ali-Pat
Dayton, OH USA - Monday, March 10, 2003 at 19:24:15 (PST)
Suzanne, I am so grateful to you for the video clips. Thank you a million times
over. You are wonderful. Thank you, Georgiana, for the information about "Smiley's
People." I appreciate everything. Juliana
Juliana
- Monday, March 10, 2003 at 19:01:47 (PST)
Was there something in the water in 1961-1962 to produce such "girls"??
Julia
Calgary, Canada - Monday, March 10, 2003 at 18:46:23 (PST)
Ali-Pat (and other Video Seekers)
I found Quigley Down Under and Galaxy Quest at Wal-mart.
Barbara the Wallpaperer <I
know, I know... Wal-mart!... I guess I WILL go anywhere for AR!foo>
- Monday, March 10, 2003 at 18:25:00 (PST)
Wanda there are several sites to see pics of AR and other stars. Here is the one we
mostly see pics from: http://www.rexfeatures.com
Cathy
FL USA - Monday, March 10, 2003 at 18:22:20 (PST)
Carolyn, dear Carolyn: Corrupter of the scholarly eh? Ah well, I knew I'd amount to something some day. My father once said I corrupted my husband. Glad to hear I haven't lost my touch.
Gissing's Girl: Glad you're enjoying TwtBD. I am currently working on the next chapter, but it's slow going due to a massive workload at my job. What I wouldn't give to be independently wealthy and write whenever I wanted to!
Kim: Thank you, thank you for recommending my fic again. You're one of the main reasons I've gotten new readers! Oh, and my story id is 1128582. There's three White Ravens out there on ff.net so it's easy to confuse them. I'm the one with the penname in all small case.
Oh, and Carolyn, dear Carolyn, I am a MWF, 35, mom of two. If I'm ever allowed to play
God for a day, I will have my own harem, where AR and Liam Neeson will reside (along with
my husband of course).
white raven
Houston, TX USA - Monday, March 10, 2003 at 18:21:30 (PST)
140 - 206 AD Antonine Wall built in central Scotland. Romans battle the Scots and
are defeated. They retreat behind Hadrian's Wall. Marcomannic War between the Celts and
the Romans. Emporer Severus invades Scotland and lays waste to the country. Scots attack
with guerilla warfare and win. The Emporer returns to Rome, vows to exterminate the Scots,
but then dies.
Hermoine Granger
- Monday, March 10, 2003 at 18:20:13 (PST)
P.S., I thought I heard "gone welly" too. And thank you Ali-Pat for the
generous offer. Do you like "Quigley"? I haven't seen it yet. Ella: hee-hee. Oh,
I forgot, I'm not supposed to post here for a couple days. I'm borrrrring people.
Dee
Pasadena, - Monday, March 10, 2003 at 18:06:56 (PST)
For those of you you who have been here a while--- do you guys remember the name of
that site that you can get picture AR and of other stars by simply typing in their names??
Thank you...in advance
Wanda
- Monday, March 10, 2003 at 18:05:47 (PST)
Uh, 44, DWF, looking for a tall, dark, potions professor with a big . . . Ooooooops,
forgot, dang. Look, if y'all knew what I did for a living, I think you would be surprised.
I spend all day with serious stuff, and when I get home, I like to have a laugh or two or
three, and quite a few of the posts here make me laugh. And I hope I'm one of the girls!!
Gosh, I'll keep my trap shut for a few days. *Sob*
Dee
Pasadena, CA USA - Monday, March 10, 2003 at 18:01:27 (PST)
Now now. We are all entitled to our opinions. But, like I was just telling JC (via
instant message) I do want people here to know that I have a little--okay, a lot--of
mental substance, but I reserve the right to get silly every once in a while.
Carolyn, dear Carolyn
CO US - Monday, March 10, 2003 at 17:32:46 (PST)
Well, hey there again. Forgot to thank you, Kim, for mentioning me on your last post
regarding fanfics. So, thank you, thank you, thank you! *sings praises*
Katie C
USA - Monday, March 10, 2003 at 16:57:09 (PST)
Hey, I'm 15- and I've got a mind like a rusty iron trap! Oh, wait, that's wrong, isn't it? *Sigh* I want to be "one of the girls." *Sniffle, sniffle*
Other than being an avid Rickman fan, I don't think anything (and yes, that includes age) has anything to do with posting here. Or talking about Mr. Rickman's willy.
So, ahem, mimimimimi.... WILLY, WILLY WILLY!
Okay, I'm done now. *Sticks tongue out* Na na na na na na.
Katie C
USA - Monday, March 10, 2003 at 16:52:22 (PST)
Claudia I think this is the link you are talking about is on Tami's site. here is
the link: http://www.nd.edu/~tchapman/alanrickman.html
Cathy
FL USA - Monday, March 10, 2003 at 16:39:51 (PST)
Good grief. Ella's got willy on the brain.
Tina
USA - Monday, March 10, 2003 at 16:39:20 (PST)
Willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy, willy.
Well, I suppose being a precocious 31 qualifies me as one of the "girls" ;-) (And you know what they say about acting your age...)
It's oh so easy to criticize others when hidden behind a pseudonym, isn't it? (!)
'Scuze me while I play with my barbies...anatomically impaired and thus forever ignorant
of the joys of discussing The Willy. *Shakes head solemnly*
Ella
PA USA - Monday, March 10, 2003 at 16:35:12 (PST)
Dee, I have no secret to getting AR videos, only the great good luck to live near a truly excellent used video store. I now have some spare copies of videos I would be glad to share with anyone who wants them. My extra copy of Bob Roberts is reserved for Anne, (although I have still not been able to reach you by email, Anne. I get your messages, but every message I send you bounces back). Anyway, anyone who is looking for any of the following is invited to email me:
The January Man
Judas Kiss
Quigley Down Under
Galaxy Quest
Michael Collins
In the case of multiple requests for the same title, I will allow the nice lady I am caring for, (who looks remarkably like an older version of me), to draw names from a basket.
No pushing! No shoving! No yelling! This ain't Nordstrom Rack!
Ali-Pat, also "one of the foolish" <sa.pe@earthlink.netfoo>
Dayton, OH USA - Monday, March 10, 2003 at 16:02:43 (PST)
Ali-Pat: in AABA I think the phrase you heard as "gone welly," may have been "gone, Lilly."
Dee: Marmite is a B vitamin-packed spread with a very intense savory taste.
I continue to be curious about the other posters here. Would it be acceptable for
people to post short descriptions of who they are without details that would ruin their
safety or security? I guess Getting Bored prodded me towards asking when she referred to
"little girls." I don't know if I was included in that group--or even if she
meant it literally-- but it made me smile. I am 50.
Carolyn, dear Carolyn
CO USA - Monday, March 10, 2003 at 15:59:15 (PST)
Yes quite a geat mind ce monsieur de Villepin. Plus he is good looking. I think he's
of the same class as AR but among the politicians.
Nathalie
Paris, - Monday, March 10, 2003 at 13:32:25 (PST)
Hello again, everybody. Hmm... I sincerely don't care whether or not Mr. Rickman's so called 'willie' is up to snuff anymore, it's his acting that counts!
Oh, damn, I'm lying. I do care. Grrrrrr. How did we get on the subject of his nether regions anyway? Oh, well, so long as he's confident in himself.
Chapter 5 of "Revealing Snape" (my fic) is almost up, so if you want to check out the first four, go ahead! (Please, please, please?) ;o)
Love ya'll!
Katie C
USA - Monday, March 10, 2003 at 13:31:02 (PST)
OK call that GREAT minds .... Thanks Renie
Claire
- Monday, March 10, 2003 at 12:48:55 (PST)
Collateral Damage reports Rickman and non Rickman can be posted as Renie suggested in Off Topic now newly spring cleaned once I found my password! Any other London play reviews welcome there.
Claire
- Monday, March 10, 2003 at 12:47:25 (PST)
I see that Claire has made Off-Topic Talking Shop available for Collateral Damage reports amd the like which don't directly involve AR. So Sue, Susan, and anyone attending who'd like to share their thoughts/experience has a place to do it. GML, sorry you can't make this Friday's CD session. I can't either.
Dominique
de Villepin is the French Minister of Foreign Affairs, and he spoke before the U.N.
National Security Council on March 7, in NY. Government leaders, officials and
professional politicians have never sparked that kind of interest in me (except maybe
fictional ones, like Lukas Hart *wink*) but the French foreign minister did deliver a fine
speech against the war.
Renie
He said, "War is always an acknowledgement of failure.", - Monday, March 10,
2003 at 12:42:40 (PST)
And I was afraid of offending you and possibly AR as well if I posted this quote!
Guess I don't need to worry about that now--and I just couldn't resist sharing this (from
"Mansfield Park") -- "'How long ago it is, aunt, since we used to repeat
the chronological order of the kings of England, with the dates of their accession, and
most of the principal events of their reigns!' 'Yes,' added the other; 'and of
the Roman emperors as low as Severus . . .'"
Lee
- Monday, March 10, 2003 at 12:02:23 (PST)
Here are some Snape stories I have read most of them are they are very good, I have
not read all yet. The web address is to the authors page on fanfic, the authors name
is next to the web address do not use it in the address. At the authors page you
will see a list of the stories they have written. Fanfic
http://www.fanfiction.net/profile.php?userid=255205, Stefynae
http://www.fanfiction.net/profile.php?userid=284420, Ricky Roo
http://www.fanfiction.net/profile.php?userid=340871, Damia Rose
http://www.fanfiction.net/profile.php?userid=342603, Katharina
http://www.fanfiction.net/profile.php?userid=5808, Werecat99
http://www.fanfiction.net/profile.php?userid=306849, The Stars Hold Nine Serpents
http://www.fanfiction.net/profile.php?userid=323146, The Bard of Skheria
http://www.fanfiction.net/profile.php?userid=323194, Superwitch
http://www.fanfiction.net/profile.php?userid=255731, rickfan37
http://www.fanfiction.net/profile.php?userid=305517, white raven
http://www.fanfiction.net/profile.php?userid=305551, Gwenn
http://www.fanfiction.net/profile.php?userid=269196, LonelySlytherin The following on at a
different web site it is Adult fanfic more explicit sex than allowed on Fanfic.
http://adultfan.nexcess.net/aff/authors.php?no=1028, VeresnaUssep Don't Lie to Me part one
of 3 part story, Secretly Slytherin part two of e part story, part 3 has not yet been
started. Great story but read author disclaimer sex in all her stories is very graphic!
http://adultfan.nexcess.net/aff/authors.php?no=1253, Dawningskies Updates on some of the
stories are very slow in coming, keep checking just when you are about to give up the
author adds a chapter. I think these will keep you busy! Message for those authors who
visit the GB and I know you do. Please update, update, up date! Some of you have kept me
waiting a very long time. Thank you.
kim <kimtauchen@hotmail.comfoo>
USA - Monday, March 10, 2003 at 11:25:53 (PST)
Instead of discussing how we are going to stop talking about "equipment",
maybe we could just stop, cold turkey? I for one, am willing.
ACC
- Monday, March 10, 2003 at 10:50:34 (PST)
There are TWO girls with hats Mortianna!!!! (Obviously it's getting a bit dim in the
dungeon!!) The tea lady is Martine McCutcheon, the one with the white hat and red coat. As
you probably have noticed she looks like your average tea-lady LOL. The Prime Minister is
Hugh Grant (the short one at the back;)))))
Sue
England - Monday, March 10, 2003 at 10:04:43 (PST)
There is an interview with The Man somewhere where he says something to the effect
"There's more to acting than the size of one's willy". Sorry I just don't know
the reference at the moment. Maybe someone can jump in and direct us to the url.
Claudia
GA US - Monday, March 10, 2003 at 09:54:05 (PST)
When Mr. Rickman mentions "equipment," he means the physicality he brings
to his acting, or so it seems to me.
Georgiana (who thinks Dee is hallucinating about that 'willy' business--giving me the
willies, however)
Seattle - Monday, March 10, 2003 at 09:41:55 (PST)
Ali-Pat shall I send you my address as we are having trouble with our computer
Gissing's Girl
UK - Monday, March 10, 2003 at 08:40:39 (PST)
I'm disgusted with my local LIBRARY. They have just written to me to say that they
can't supply me with a copy of Barchester Chronicles. What are they playing at all they
have to do is go out and buy a set. Especially as I work in a LIBRARY you'd think that
they'd make an effort. There must be other borrowers out there that would like to see it
too. Guess I'll have to buy it-how awful!Just been reading the last chapter of TwtBD It's
a great story and seems to be building up to a great climax with Grace. Rickfan37 I like
the painting with light reference in Snape in Love Anyone know of anymore Snape Stories on
FanFiction, I seem to be fascinated by them or is it Him?
Gissing's Girl
UK - Monday, March 10, 2003 at 08:39:00 (PST)
thanks loads for the Love Actually pic. I'm so looking forward to the film, this one
will at least get released, with the hordes of famous people in it. I think Emma looks
wonderful. Erm, any other person I should spend a special look on? Sue, my dearest English
dictionary - who of the young girls would be the tea lady? the one with the - hat?
mortianna
still dungeon, still in Germany - Monday, March 10, 2003 at 07:59:45 (PST)
I find male anatomy conversations rather hilarious as a rule, but not with little
girls who are displaying an embarrassing lack of experience and knowledge and an equally
large amount of tackiness on a public website. The ones you see in magazines or the Net
are not representative, you know ;). (As for the 'equipment', I suspect he was referring
to his acting skills or fitness as a whole, don't be so girlish). And: when it comes to
JOKES, the best ones are the shortest ones. Thanks. Now can we move on please?
Getting Bored
UK - Monday, March 10, 2003 at 07:27:38 (PST)
Thanks, GML, for the tips on getting into the National. It sounds very doable, even
if I haven't slept in 36 hours (flying in that morning). Just got to ditch the hubby and
kids (babysitters, anyone?) Fortunately the hotel has a heated pool. BTW, I love AR for
his mind, which never shrinks in the cold!
susan
- Monday, March 10, 2003 at 07:27:03 (PST)
Mr. Rickman's screen time in "Smiley's People" is, I would estimate, less
than a minute. Only the foolish . . .
Georgiana ( . . . like me . . . )
Seattle - Monday, March 10, 2003 at 07:10:07 (PST)
Aussiegirl: The tripod thing at the wallpaper website is purely coincidence--I, uh, think!
Suzanne--those videograms are nifty. Thanks for the links. I note in The View, #1, he says his genitals are intact (while touching himself!!!) *faint* again. Come to think of it, I've seen two other interviews where he mentio